SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000005641 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000005641
Domain Number 1 Region: 61-307
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.45e-61
Family Ankyrin repeat 0.0000075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000005641   Gene: ENSGALG00000003568   Transcript: ENSGALT00000005651
Sequence length 571
Comment pep:known chromosome:WASHUC2:20:3754443:3800226:1 gene:ENSGALG00000003568 transcript:ENSGALT00000005651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAHVDLLTELQLLDKVPTLERLRAAQKRRAQQLKKWAQYEKEMQHKKRKHEKKRNAVNR
KKVSFEASVALLEASLRNDLEEVCYLLKSNISPDLCNEDGLTALHQCCIDNYEEIVKLLL
SHGANVNAKDNELWTPLHAAATCGHINLVKILIQHGADLLAVNADGNMPYDLCEDEPTLD
VIETCMAYQGITQEKINEMRAAPEQVMICDIHDILATGQDLNRTDAQGATLLHIAAANGY
LHAAEVLLDQGASLDVKDWDGWEPLHAAAFWGQMQMAELLVSHGASLSARTSLDEMPIDL
CEEEEFKVLLLELKHKHDVIMKSQMRHKSSLSRRTSSTGSRGKVVRRASLSDRTNLYRKE
CEKEAIVWQQLGAAEEGRNSGLIGEIGETRSDQENTDPNSLLESSSLFPELANKSTQCDS
EIPLQNGLMASASTYPYTFSNGDVWSMHADPDGNPGHVLPYGSPALPDAQQFWGAYKEQG
HQTLSELKRQRAAAKLLNHPFLSTHFGSGVGGVAENGGEAKSHLIASRTSPYSSNGTSVY
YTVSSGEPPLLKFKAPMEEMEEKVHGCCRIS
Download sequence
Identical sequences Q5ZHY3
ENSGALP00000005641 NP_001026022.1.86415 ENSGALP00000005641 9031.ENSGALP00000005641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]