SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000006407 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000006407
Domain Number 1 Region: 255-317
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000753
Family PHD domain 0.005
Further Details:      
 
Domain Number 2 Region: 28-107
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000122
Family PHD domain 0.0014
Further Details:      
 
Domain Number 3 Region: 815-875
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.0000000497
Family FHA domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000006407   Gene: ENSGALG00000004029   Transcript: ENSGALT00000006417
Sequence length 1007
Comment pep:known chromosome:WASHUC2:19:5847013:5873681:-1 gene:ENSGALG00000004029 transcript:ENSGALT00000006417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKMETKTIVYDLDTSGGCPQQIQALLAPPKSEDGEKRSRRPEKEPRRSGRATNHDSCDSC
KEGGDLLCCDHCPAAFHLQCCNPPLSEEMLPPGEWMCHRCTVRRKKREQKKELGQVNGLV
DKTGKRTTSPTSDADLLDRSSSSIRANAHARILERRASRPGTPTSNASTETPNSEQNDVD
EDIIDVDDDSAIAEMDCGQPQLKRPFELLIAAAMERNPTQFQLPNELTCTTALPGTSKRR
RKEETTGKNVKKAQHELDHNGLVPLPVKVCFTCNRSCRVAPLIQCDYCPLLFHMDCLEPP
LTAMPLGRWMCPNHIEHVVLNQKNLTLSNRCRVFDRFQDTISQHVVKVDFLNRIHKKHPP
NRRVLQSVKRKGLKVPDAIKSQYRLPPPLLAPAAIRDGELICNGIPEEPLQKHLLNTEHL
ASQTEQQEWLCSVVALQCSILKHLSAKQMTSLWDSEQTEKADIKPVIVADGTLANPYQAA
DKAPTPSLYSMSSCTSGITTQNSLSSSQSQQTLSQEDVNCSSCLDKSKKVSSCGTSNGPT
ASDVKVNGPHFYGVSSEPSAQLTDSQRLIGAGNTIPVLSHRQTWPRPLTPPATCGLLNHT
IGTIVKTENVGGPVSCAQRGSVPVTSMPTSISSSCASLETTSTLQRKNVQTQIGPPLSAD
LRSMGSPLTATRALTPPQAAGDGISAVGSANRFCSPAPPSDGKVSPSTLSIGSALTLPSS
LTSNSAAMLDLTSSLKAFMDGEIEINMLDEQLIKFLALQRIHQLFPSKAQSLASSVSAHQ
QSPVANHIEAQRKEVQARAVFYPLMGLGGAVNMCYRTLYIGTGADMDVCLTSYGHCNYVS
GKHACIFYDENTKHYELLNYSEHGTTVDNVLYSCDFSEKMAPTPPSSIVAKVQSVIKRHK
SRKQEEEPHGEAAVMNSQAQGQHRKPCNCKASSSSLIGGSGAGWEGTALLHHGSYIKLGC
LQFVFSITEFATKQPKGDTALVQDMDLEEKLSLKPHQVPVLRSNSVP
Download sequence
Identical sequences 9031.ENSGALP00000006407 ENSGALP00000006407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]