SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000006565 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000006565
Domain Number 1 Region: 356-563
Classification Level Classification E-value
Superfamily PUA domain-like 3.23e-79
Family SRA domain-like 0.00000000366
Further Details:      
 
Domain Number 2 Region: 272-325
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000014
Family PHD domain 0.0014
Further Details:      
 
Domain Number 3 Region: 653-709
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000353
Family RING finger domain, C3HC4 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000006565   Gene: ENSGALG00000004132   Transcript: ENSGALT00000006575
Sequence length 733
Comment pep:known chromosome:WASHUC2:28:4388722:4397932:-1 gene:ENSGALG00000004132 transcript:ENSGALT00000006575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QMEDGHSLFDYSVGLNDIVQLLVRQSPAVLPAVSKEKDSELSDTDSGCGSGQSESDKSSH
NGEGAMDLEGQSSTAAQADWADPGFGLYKIHDLVDARDMNMGAWFEAQVVNVTRRKAANE
SCAVADQQTTIPEEDVIYHVKYEDYPENGVVELSSNDVRSRARTILKWHQLEVGQVVMVN
YNPDEPTERGFWYDAEILQKRETKLIREINAKILLGEAGDSLNDCRIIFVDDIYKIEEPG
SVCPISARPLKRQSGPVCKACKDNPNKTCRICACHICGGKQDPDKQLMCDECDMAFHIYC
LNPPLSSIPDDEDWYCPECRNDASEVVLAGEKLKESKKKQKMASANSSSRRDWGKGMACV
GRTKECTIVPSNHYGPIPGIPVGTMWKFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAG
GYEDDIDHGNSFTYTGSGGRDLSGNKRTAEQSCDQKLTNMNRALALNCSAPINDKNGAEA
KDWRAGKPVRVVRNVKGGKHSKYAPVEGNRYDGIYKVVKYWPETGKSGFLVWRYLLRRDD
EEPAPWTKEGKDRMKKLGLTMQYPEGYLEAVANKDKENNGDDEFDTPGKGKRKRKSAGAE
EKVVSSPAGTPKKTKVEPYKLTTQQKSLIRSDEANEKLWNEVLDALKDGPYEKFLNKVEE
AFLCICCQEVVFRPVTTVCQHNVCKDCLDRSFKADVYSCPACRYDLGKNYTMQVNETLQT
ILTQLFPGYGNGR
Download sequence
Identical sequences ENSGALP00000006565 9031.ENSGALP00000006565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]