SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000007393 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000007393
Domain Number 1 Region: 194-360
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.11e-17
Family Ankyrin repeat 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000007393   Gene: ENSGALG00000004649   Transcript: ENSGALT00000007405
Sequence length 843
Comment pep:known chromosome:WASHUC2:19:6605882:6616453:1 gene:ENSGALG00000004649 transcript:ENSGALT00000007405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSILEKMKKFGSSDIEESEVTDEHTDGEDSALETADNLQGTFSNKVQPSKSNIFARRGR
FVMGDCDKDMAPMDSFYQMDHLMAPSVIKFHANMERGKLHKLLSTDSITGCSEKAFKFYD
RRRIFDAVARGSTKDLDDLLLYLNRTLKHLTDDEFKEPETGKTCLLKAMLNLHDGKNDTI
PLLLDIAKKTGTLKEFVNAEYTDNYYKGQTALHIAIERRNMYLVKLLVQNGADVHARACG
EFFRKIKGKPGFYFGELPLSLAACTNQLCIVKFLLENPYQAADIAAEDSMGNMVLHTLVE
IADNTKDNTKFVTKMYNNILILGAKINPILKLEELTNKKGLTPLTLAAKTGKIGIFAYIL
RREIKDPECRHLSRKFTEWAYGPVHSSLYDLSCIDTCEKNSVLEIIAYSSETPNRHEMLL
VEPLNRLLQDKWDRFVKHLFYFNFFVYAIHISILTTAAYYRPVQKGDKPPFAFGHSTGEY
FRVTGEILSVLGGLYFFFRGIQYFVQRRPSLKTLIVDSYSEVLFFVHSLLLLSSVVLYFC
GQELYVASMVFSLALGWANMLYYTRGFQQMGIYSVMIAKMILRDLCRFMFVYLVFLLGFS
TAVVTLIEDDNEGQDTNSSEYARCSHTKRGRTSYNSLYYTCLELFKFTIGMGDLEFTENY
RFKSVFVILLVLYVILTYILLLNMLIALMGETVSKIAQESKSIWKLQRAITILDIENSYL
NCLRRSFRSGKRVLVGITPDGQDDYRWCFRVDEVNWSTWNTNLGIINEDPGCSGDLKRNP
SYCIKPGRVSGKNWKTLVPLLRDGSRREETPKLPEEIKLKPILEPYYEPEDCETLKESLP
KSV
Download sequence
Identical sequences F1NJH8
9031.ENSGALP00000007393 ENSGALP00000007393 ENSGALP00000007393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]