SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000008062 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000008062
Domain Number 1 Region: 269-517
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.02e-36
Family Protein kinases, catalytic subunit 0.0006
Further Details:      
 
Domain Number 2 Region: 26-142
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.23e-23
Family Ankyrin repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000008062   Gene: ENSGALG00000005037   Transcript: ENSGALT00000008076
Sequence length 1414
Comment pep:known chromosome:WASHUC2:19:7007231:7031040:-1 gene:ENSGALG00000005037 transcript:ENSGALT00000008076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHALPLPIPCPVQLGSLKGDSLEAQLHECVRQGNCGKVKKLLKKGTFVDAVNSMGQTSL
FTAALLGLGKIVDVLLDYGSDPNHRCYDGSTPVHAAAFSGNQWVLSKLLDEGGDLRVHDE
GGKNPQYWAMSAGKESSAQMLEFIQRCTFHMQAAIQNFPCDPVRKICSSKALVSSPSRFG
GLVQGNADSPLGRFLKDGVNAAKNIYSFGFGKVLVLFQFYLAGSRHVGYLASLPIIGEKE
VVQADDEPTFSYHVGPCMIMTNLMWGSSRVTVKELSFQPHQNCAKLRLADLLIAEQEHSS
KLRHPHLLQLMSVCLSSDLEKTRLVYERVNFGSLYSILHERRAEFPVLRMETILHILLQI
NDALRFLHSRGFIHRTITSYAIQIVSSGEAKLCNMEYMIESKDGGEHSDLTRIPVPAQLY
KWCSPEVILEKSVTVKSDIYSFCTVMQEALTETLPWKGIEDSVIKQLIISGQQLEADVRL
PVPYYDIVKSGLESKQKNRSMTLQDIQYILKNDLKDLTKSQSCHADEMAKAQRPAVFADI
NICLSSTFSYRKRTLELNEKGITEADSSAAPRYPIFPEENNALVDLEAPTSLQLAAQENN
HDAASETQMTCSVSDVDDSLCSFEMNEVFASCPDFHEDFLEEGAELSQTLKDKKRQQKEK
DENVLGDLFLSPGMCCEEKPVYEEGSISESVAEYTTEEEEGKSEASDLNVLAQVRGDAGR
RSTLSSNEHHISKCVLNLKIVQSMLQQAAESLCRTEEKLDKLEAVEKQRKLLQEVWTNQL
SNPFSGAHAFLWKAVGPPSSDYIPPLVTCQSQGALRGDGFQTVSNVSEEMWAIQNEKWKC
FHQRSKGKKENSQHDLSFNEVSGKGDVVMSGIQAEAKGWNCHCFSKEKHRYQRGSDSHSS
ASGSKEERWCYPKPASEIHSMKISEERRMMQPEWRTEVRQMARKVASGQLELIAPYLASD
CTSESEVESIKEAFQHVTSRVQKGRDQREDRWRTGDNAEPWDGGCEDGSESEESDLESIF
RSSGGGSCQSPSQDEQAESGLSVHKNSVTFQQIETVSRGHSRELPCSFSSYPSESEEFLT
PDPDYFLPAAVEESSEPKVKDKHNRKSVGVIAAFPVCQYLYSLLSTGGNELPVSKVEVYS
STEAAQEVISRELQEDSEEKDISVTDIQDLSSIPCKEENYYEDINCRSPGVSHAPPSVST
PISSEERIPVAFEKHRCCHEVVLDSSSCICQEVSSAVSRTFTTAYEEERSTEVLSSSPSV
CSSGLNEPVEKTCFVGGGSWHSGLLVCQQPVAYQNHSEFTTEAPVHLLDELPAPAQELLD
EIECLKQQDSIARDSVEEGLCDCRVQKNDSDRIKMEGTEAKKEIEISEKCDCSVWTMETF
NLAEETESRAHSTLDDALERILYAVPADEQIQEQ
Download sequence
Identical sequences 9031.ENSGALP00000008062 ENSGALP00000008062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]