SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000009770 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGALP00000009770
Domain Number - Region: 178-202
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0011
Family CCCH zinc finger 0.0034
Further Details:      
 
Domain Number - Region: 13-41
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0314
Family CCCH zinc finger 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000009770   Gene: ENSGALG00000006066   Transcript: ENSGALT00000009784
Sequence length 348
Comment pep:known chromosome:WASHUC2:4:3493228:3544246:-1 gene:ENSGALG00000006066 transcript:ENSGALT00000009784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVNVSLVRDTKWLTLEVCREFQRGTCSRSDAECKFAHPSRSCHVENGRVIACFDSLKGR
CTRENCKYLHPPPHLKTQLEINGRNNLIQQKTAAAMFAQQMQFMLPGTQLQPITTFPVTP
SLATSPTMAFSPYLSHVSPGMGLVPAELLPNTPVLVSGNPTVTVPGSSAGQKLMRTDKLE
VCREFQRGNCTRGENDCRYAHPIDIAMIDTNENTVTVCMDYIKGRCSREKCKYFHPPAHL
QAKIKAAQHQVNQTAAAAMALPPGALQPLPKRPALEKNNGATTVFNPSVFHYQQALANMQ
LQQPTFIPTVPMMHGATPTTVSAATTPATSVPFAATATANQISQLSVD
Download sequence
Identical sequences ENSGALP00000009770 9031.ENSGALP00000009770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]