SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000013790 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000013790
Domain Number 1 Region: 956-1208
Classification Level Classification E-value
Superfamily SET domain 1.96e-83
Family Histone lysine methyltransferases 0.0000402
Further Details:      
 
Domain Number 2 Region: 691-936
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.7e-72
Family Ankyrin repeat 0.0000711
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000013790   Gene: ENSGALG00000008472   Transcript: ENSGALT00000013805
Sequence length 1249
Comment pep:known chromosome:WASHUC2:17:2432926:2488641:1 gene:ENSGALG00000008472 transcript:ENSGALT00000013805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVDAEQTVLSKGETRKDACMKTELLKDITNNKEEGFNAMAADESATEKQVGEPKMAVD
GETNGSCEHGEAGSHPNPAKNTQDNTKVSQQDSSTKLNRIAENGISERDGETGKQNHMKA
NDFTQTSLTGSNGYILTKQMAQEQPLRTTSTFASLTGHAAKTLPGGASKGRTVGTFSQMQ
ATMPTKLGEGSKDMDAKKATAANAEVKVHRARKTMPKPTPSLHASKDPKDGRDSRDQKES
KEEGNKNILEFGKPLPLPSLPGLHQSLPQNQSYVATSKSQTAAAVSRKKKRRMGTYSLVP
KKKTKVLKQRTMIEMFKSITHSSAGAKSEKELGDVSPHVNGESIDVDSEEEDSDELEDED
DHGAEQAAAFPADDNRTSKDSASDADNVRKIDDGDSEEEQESAESGEDEEDGDESDLSSE
SSIKKKLLKRKGKTDSPWLKPTRKRRRRNKKKQANVLGAEAYKSSLGGREGSAQDNSMEY
MEVSLDSLDLRVKGILSSQAEGLSNGPEAMEVDGLQEVPLCSCRMETPKSREITTLANNQ
CMATESVDNEGSLNPCARPCFAFFCLHSSWQSKVFAGLFCATVPEELSKHRAVCQFKINF
LSFFGVRYTQCCIFLMVVLWFYLLFSVTGTRLSEEDKPESSAAEGFDLAGSSVFPKPTTS
LTQGPVKETLESALIALDSEKPKKLRFHPKQLYFSARQGELQKVLLMLVDGIDPNFKMEH
QSKRTPLHAAAESGHVDICHMLIQAGANIDSCSEDQRTPLMEAAENNHLETVKYLIKAGA
LVDPKDAEGSTCLHLAAKKGHYDVVQYLLSIGKMDVNCQDDGGWTPMIWATEYKHIELVK
LLLAKGSDINIRDNEENICLHWAAFSGCVDIAEILLAAKCDLHAVNIHGDSPLHIAAREN
RYECVVLFLSRGSDVTLKNKEGETPLQCSSLNSQVWVALQMNKTLRESSTEKPVQIEKVV
SRDIARGYERIPIPCINSVDSEPCPSNYKYVSQNCVTSPMDIDRNITHLQYCVCIDDCSS
SNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECNHACSCWRTCRNRVVQNGLRTRLQL
YRTQKMGWGVRTMQDIPLGTFVCEYVGELISDSEADVREEDSYLFDLDNKDGEVYCIDAR
FYGNISRFINHLCEPNLIPVRVFMSHQDLRFPRIAFFSTRHIEAGEEIGFDYGDRFWDIK
GKFFSCQCGSPKCKHSSSALAQRQASTSSQDTQENGLPDTSSATAAGPF
Download sequence
Identical sequences ENSGALP00000013790 9031.ENSGALP00000013792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]