SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000013840 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000013840
Domain Number 1 Region: 829-898
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000297
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.036
Further Details:      
 
Domain Number 2 Region: 358-425
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000662
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.063
Further Details:      
 
Domain Number 3 Region: 4290-4336
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000259
Family PDZ domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000013840   Gene: ENSGALG00000008499   Transcript: ENSGALT00000013855
Sequence length 4336
Comment pep:known chromosome:WASHUC2:1:10400645:10420607:1 gene:ENSGALG00000008499 transcript:ENSGALT00000013855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDTTHHPRQPGKPPDPGPGLSKSRTVDVLKTEQRAPGRSPSSISLRESKSRTDFKEDQKP
SMMPSFFSEANPLSAVTSVVNKFSPFDLISDSDAAHEEAGRKQKVTQKEQGKPEEQRGLA
KHPSQQQSPKLVQQQGPVKPTPQQTESSKPVPQQQQPGEPKQGQKPGPSHPGDSKAEQVK
QPPQPRGPQKSQLQQSEPTKPGQQQTSAKTSVGPTKPLPQQPDSAKTSSQASPPTKPSLQ
QSGSVKQPSQQPARQGGPVKPSAQQAGPPKQQPGSEKPTAQQTGPAKQPPQPGPGKTPLQ
QTGPVKQVPPQAGPTKPSSQTAGAAKSLAQQPGLTKPPGQQPGPEKPLQQKQASTTQPVE
STPKKTFCPLCTTTELLLHTPEKANYNTCTQCHTVVCSLCGFNPNPHITEIKEWLCLNCQ
MQRALGGDLASGHGPGPQLPPPKQKTPTPASTAKPSPQLQPGQKKDASPKPDPSQQADSK
KPVPQKKQPSMPGSPPVKSKQTHAEPSDTGQQIDSTPKSDQVKPTQAEEKQNQPSIQKPT
MDTVPTSAAPGVKQDLADPQPPSIQQKVTDSPKPETTKPPADTHPAGDKPDSKPLPQVSR
QKSDPKLASQSGAKSDAKTQKPSEPAPVKDDPKKLQTKPAPKPDTKPAPKGPQAGTGPRP
TSAQPAPQPQQPQKTPEQSRRFSLNLGGITDAPKPQPTTPQETVTGKLFGFGASIFSQAS
SLISTAGQPGSQTSGPAPPATKQPQPPSQPPASQAPPKEAAQAQPPPKAAPTKKETKPLA
SEKLGPMASDSTLTTKGSDLEKKPSLAKDSKHQTAEAKKPAELSEQEKASQPKVSCPLCK
TGLNIGSKDPPNFNTCTECKKVVCNLCGFNPMPHIVEVQEWLCLNCQTQRAMSGQLGDMG
KVPLPKLGPSQPVSKPPATPQKQPVPAVSHSPQKSSTPPTPAATKPKEEPSVPKEVPKLQ
QGKLEKTLSADKIQQGIQKEDAKSKQGKLFKTPSADKIRVSQKEDSRLQQTKLTKTPSSD
KILHGVQKEDIKLQEAKLAKIPSADKILHRLQKEDPKLQQMKMAKALSADKIQPEAQKED
VQLQEVRLSKAVSADKIQHGIQKDLNLQHVKIEKTSSVEKIQEAQKESKLQQDKLPKTLS
EDKIPATVSSDHKKLLSKSEEDKKPELLEKSTPHPKDKKEQITAETTGHITEQKVEVEAP
CDKLHEKKQEDVKKEDLTTGIPQMVSKPEKAEEEKTPVPVSRLPRSDHVEAVREKIEKED
DKSDTSSSQQQKSPQGLSDTGYSSDGISSSLGEIPSHIPSDEKDLPREPSQKDTISQESP
PSPSDLAKLESTVLSILEAQASTLTDEKSVKRKELYETYSEQTKDQHKTKPLPVTPESYS
SDEEDLEAIQEGERTIAADSKGGASSQTDYKEEDGGNDTPARRQRYDSVEDSSESENSPV
PRRKRRASVGSSSSDEYKRDDSQGSGDEEDFIRKQIIEMSADEDASGSEDDEFIRNQLKE
ISVTESQKKEEVKSKAKGTAGKHRRMARKSSAGYDEDAGRRHSWHDDDDETFDESPEPKY
RETKSQDGEELAISGGGGLRRFKTIELNSTITSKYSETPKQQKGILYFDEEPELEMESLT
DSPEDRSRGEGSSSLHASSFTPGTSPTSVSSLDEDSDSSPSHKKLGGESKQQRKARHRSH
GPLLPTIEDSSEEEELREEEELLKEQEKQRELEQQQRKSSSKKSKKDKDELRAQRRRERP
KTPPSNLSPIEDASPTEELRQAAEMEELHRSSCSEYSPSIESDPEGFEISPEKIIEVQKV
YKLPTAVSLYSPTDEKLIGALKEESGQKTLKSAEEVYEEMIHKTHKSKSFQIASEKDEVF
EKESLYGGMLIEDYIYESLIEDTYNGTVDTNLAMRQDESNEYIQQRGKEKKIRASEQIYD
EPQKITDLQEDYYSVEPLCSIVPQEDIVSSSYIIPESHEIVVLDSTVTSTTEEKQLLDAE
AAYEELMKKQRMQLTPGSSPTQPTSDLAPTSDMKVSSIGEIADSTSLTSSTTSAISDVSS
LSSIALSIPDVKITQHFTAEEIEDEYLTDYAREIQEIISHETSMLTYSEVSEGAASILPS
DTASLTSSTSSVCTTDSSSPIDSATTGYVDTSDAVSKLVDSEDIIAQVPFTSTEEYSEVS
MPYESVAGATTKPAIASDMDTVHQAAVCLPETAPSVFTTTVIKPKQYASDTITYDISTAE
KDAARKMKSTVETGIIKIHHEDSHKELSLDMTRINLTGATSEQPPLCVASVSVKEPASET
PAVPTPRVVSKTSTVSMPSSAPALTSKVFSLFRSSSLDSPAQPSPPSPPPPPPPPPPPLP
PPILPKPAIYPKKKSQIQAPMATAPTAVPLVTSVATLESAAVLKNHVVPVTKTYTPTPPP
VPPKPSSIPAGLVFSHRPTEVTKPPIAPKPAVPPLPIAVHKPAETQPPIGLSLTSSMTLN
LLSAEYKPSPTSPFGLTLLTNSSPRLNKTPSAGKPNVXXXXHPGDVIDLRTTKVDIEMRD
SCMDLSAVSMDARRQMPTSDTGRPVSTVQPAINLSTACVADPSLSIVTETVAVMTCTATV
SYSASTDSLVDLGHAMTTPLQLTTSKHFEPAYRVTSSQPFPVSRDEVPINLSLGTSAHAV
TWAATKPVTVPPVSVTNGWTDLSTSQEPMEIGAVDLSTTKSHRTVVTMDESTSGIITTVI
EDDEKPVDLTAGRRAVCCDMVYKLPFGRSCTAQQPPTTLPEDRFGYRDDHYQYDRSGSYG
YRGMGGMKPSMSDTNLSEAGLFAYKSKNSFDYQVGATDAAVDLTSGRVTSGEVMDYSSKT
TGPYPETRQVISGIGISTPQYSQARMVSSLSSPFGAGSVLRSSNGVVYSSVATPIPSTFA
ITTQPGSIFSTTVRDLPTLQTIDSVPSLSTLQQNQPLPRSYSFLTTMAAEKDASTTLDIE
TGLPPLTLESIATEPTNLIPATASEVYTDVIEDEVALIIAPEEGKQQQLDLERELLELEK
IKQQRFAEELEWERQEIQRFREQEKFMVQKKLEELQSMKHHLLFQQEEERQAQYMMRQET
LAQQQLQLEQFQQLQQQLHQQLEEQKIRQIYQYGYDPSGTGSPQTTTDQALLEGQYATAE
NGQFWPTDDATTTASGVLGIEIPQSQTWYTVQSDGITQYIPRSGILSSVSEMSLKDIDVR
EEKQLKKRSSMPKLRGPYEELEESLEEEPRCYKKIVDSGVQTDDEDGADRGYTNRRRRTK
KSVDTSVQTDDEDQDEWDLSSRSRRKPRVGKYSESTTEADKAKQFSKVSSIAVQTVAEIS
VQTEPVGTIRTPSIRARLDAKVEIIKHISAPEKTYKGESLGCQTETESDTQSPQYLSASS
PQKDKKRPTPLEIGYSSHLRPDSTLQVVSSPPKSPKVLYSPISPVSPSKVIESAFVPYEK
SITDDISPQKMLHADIAKVPPSSPKAAKMMQRSMSDPKPLSPTAEDSSRAQFQYTEGFMT
KGSSSITPSGTQKKVKRTLPNPPPEEATAGTQSPYTSVGSVSRRRICRTTTMARAKILQD
IDRELDLVERESAKLRKKQAELDEEEKEIDAKLRYLEMGINRRKEALLKEREKRERAYLQ
GVAEERDYMSDSEVNNTRSTRIETQHGLERPRTAPQTEFNQFMPPQTQPETQFAPATSPY
GQYQYSSPALPTQAPTQFTQQSHYQQQQPLYHQQVSPYQTQTAFQTGATMSFTPQAQPPP
TQQPSYQLSSQMMVIQPKPRQTPLYLEPKITTNYDVIRNQPLMIAPVSTDNNYAVSQLGS
KYTTLDLRIGLDERNSIASSPISSISADSFYADIDQHHTPRNYVLIDDIGELTKGTGALG
SGFSLHEKDLTKTDRLLRTTEARRAQEVSDFLAPLQTSSRLHSYVKADEDPMEDPYELKL
LKHQIKQEFRRGAESLDHLAGLSQYYHPEGSFRHFPKSEKYSIGRLTLEKQAAKQLPAAL
LYQKQSKHKKALIDPKLTKFSPIQESRDLEPDYSTYMTSSSTSSLGGITTRARLLQDDIT
FGLRKNITDQQKYMGAPLTSSIGAGLGAALGPTMRSTLQDEADKSYSSGSRSRPSSRPSS
VYGLDLSLKRDSSSSSLRLKAQEAEPLDVSFSHAAPSGRTKPTSLPISQSRGRIPIVAQN
SEEESPLSPVGQPMGMARAAAGPLPPISADTRDQFGSSHSLPEVQQHMREESRTRGYDRD
IAFIMDDFQHAMSDSEAYHLRREETDWFDKPRESRLENGHGLDRRLPEKLSHSRPPSQHQ
DQISCQINGKPLQYIFPHARLKLLRDPKDHTVSGNGLGIRVVGGKEIPGSSGEIGAYIAK
VLPGGNAEQTGKLIEG
Download sequence
Identical sequences 9031.ENSGALP00000039055 ENSGALP00000013840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]