SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000014312 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000014312
Domain Number 1 Region: 55-411
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.67e-67
Family Ankyrin repeat 0.0000161
Further Details:      
 
Domain Number 2 Region: 526-581
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000275
Family SOCS box-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000014312   Gene: ENSGALG00000008814   Transcript: ENSGALT00000014328
Sequence length 590
Comment pep:known chromosome:WASHUC2:1:24068600:24078002:-1 gene:ENSGALG00000008814 transcript:ENSGALT00000014328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDESEDVVEDLITEYAIQLSIQESNAAKPRMSSFSDSFVPPSEENRKIVTAIKEGQIFG
LQDLVKWKYALDEADERGWFPLHEAAAQPIQQILEIILDASYKAMWEYKTSDGETPLTLA
AKAGYVGNVRALLEKGVWPNTTNDKGETPLLIAVRSGSFEMASTLIKHNCRIHQPCVKRW
SAMHEAAKQGRKDIVSLLLKNGGNVNLKDGYGVTPLGVAAEYGHCDVLEHLIHKGGDVQA
LADDGSSILFEAAGGGNPDCIALLLEYGGSGNVPNKAGLLPIHKAAYEGHYLVLKYLIPV
TSQTAIQKSGISPVHSAADGQNSQCLELLIESDFDVNTILDDHISNSYDDERKTALYFAV
SNNDILCTEILLKAGANPNKDPLNCLLVAVRGGNHEIVRLLLSYGANVNCYFMMVNDTHF
PSAIQYALNDEVMLRLLLNHGYNVELCFDCMHQDTFGNSFVWSTPEEEILPGWTSSVIKD
NPFCDFIAVPWLKHLAGKVVRIFIDYMDYVPLCTKIKFVLETQKEWTEIRQILDNPRPLK
HLCRLKIRKLMGLWRLQKLSSMKKFPLPPVLKNYILYKEYDLYGKEIHLE
Download sequence
Identical sequences E1BRU8
XP_004937581.1.86415 XP_415996.2.86415 9031.ENSGALP00000014312 ENSGALP00000014312 ENSGALP00000014312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]