SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000014616 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000014616
Domain Number 1 Region: 17-236
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.3e-38
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 512-645
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.83e-38
Family Ankyrin repeat 0.00081
Further Details:      
 
Domain Number 3 Region: 223-306
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000621
Family Ankyrin repeat 0.0043
Further Details:      
 
Domain Number 4 Region: 327-404
Classification Level Classification E-value
Superfamily EF-hand 0.000000975
Family Calmodulin-like 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000014616   Gene: ENSGALG00000008996   Transcript: ENSGALT00000014632
Sequence length 766
Comment pep:known chromosome:WASHUC2:3:14665607:14679837:-1 gene:ENSGALG00000008996 transcript:ENSGALT00000014632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPVDNRLRNLQIYKLLQCVHQKDKKQIEKLIQNGFPNLINFTEPMDGHSALSLACIKND
IDMCSFLLERGAHPDVQDKMGCTPAMKAAELGHSLVLELLAKIKADMTIVDNEGKGVLFY
CILPTRRHYHCTQIALDYGADINNCSTDGKPVFLQACEQAHDIKEICLNFLERGANPNAR
DPVTGRTAIMEAAREGALEVVRGILERGGDINLFDNERHNAAHFAAKGGFFEILRIISAY
NGDLGLIAMNGNTPLHYAAEGGFANCCKFIGQRGCDPTWTNLLAKTPRAVAKEGGFKAAA
TELHKIEKNFIKQSKPGAKENNPLWALRLYDWSLEHQTALLQAFEAVDQGDGTVAKDDFI
SVIQKWCSFVDAEQIQTIAEAHEKPDSEGINTEEFFKGFKYLQKSCLITSFGPKRKKGKK
GKKRRSKKSVAVPVPICVIPKSACLLREDGFPVYMIEAVQNTADSYHINQDHPSAHPVHD
DRAWYTDEPRKMYMNINFLVRVGDILSLQKAFEEGVPVDIKDKYYKTPLMAACTSGNIDV
VRYLLEKGADVNATDNFMWTPLHHACYNGHLDIAELMVKAGGAIDAPAIGNATPLMRAVE
ICRLDIVHFLIDAGADVQTTNSNGKNALDIAKVFADSRIIDLLQNKLDNLPKVTEKKGAE
KGTVAKPKMPSAPTPSEVQAPSHASLPPLEKPRLEKPAQDSVVYLNSLISSGATKKDDIA
FKPRKIWTPDAATKELVRKQELLWERSTLGGDSENFESPFKRKVTE
Download sequence
Identical sequences 9031.ENSGALP00000014616 ENSGALP00000014616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]