SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000014665 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000014665
Domain Number 1 Region: 308-377
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 9.08e-25
Family PHD domain 0.0001
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000014665
Domain Number - Region: 3-47
Classification Level Classification E-value
Superfamily Staphylocoagulase 0.00392
Family Staphylocoagulase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000014665   Gene: ENSGALG00000009023   Transcript: ENSGALT00000014681
Sequence length 384
Comment pep:known chromosome:WASHUC2:1:25215324:25229309:-1 gene:ENSGALG00000009023 transcript:ENSGALT00000014681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DAMDQLEQRVNEFFMNAKKNKPEWREEQMTSIKKDYYKALEDADEKVQLANQIYDLVDRH
LRKLDQELAKFKMELEADNAGITEILERRSLELDTPSQPVNNHHAHSHTPVEKRKHNPSS
HHGATDHVPEKKFKSEALLSTLTSDASKENTPGCRNNNSSSSSNNAYNTNSSQPLASYNL
GSLSSGSGAGAITMAAAQAVQATAQMKEGRRTSSLKASYEAFKNNDFQLGREFSLSRDST
GYSSSALASTLTQTLSSSSTDSRSGRKSKNNNKSSSQQSSSSSSSSSLSSCSSSSALAQE
LSQQTAVIPESDSNSQVDWTYDPNEPRYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLT
EAPKGKWYCPQCTAAMKRRGSRHK
Download sequence
Identical sequences G1N979
ENSMGAP00000008949 ENSGALP00000014665 ENSMGAP00000008949 9031.ENSGALP00000014665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]