SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000014703 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000014703
Domain Number 1 Region: 41-171
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000363
Family Ankyrin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000014703   Gene: ENSGALG00000009041   Transcript: ENSGALT00000014719
Sequence length 274
Comment pep:known chromosome:WASHUC2:3:8070625:8071446:1 gene:ENSGALG00000009041 transcript:ENSGALT00000014719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RHCKFLSYMFYQAVRDHKPVWMLEDMRTMEYFYWEENASLRTYSPSEALLYAVVHNHLPY
AQYLLSHFPEEALKVPGEHFCYCPSSAPHLAMAVTYDRRDILGLIIKIAHKLPSLNSYIN
RTGCFHLEDGKTPLHLACELLRSETVLILLGNGASPRIEDSKGLTPLDVILEQMWDSKVN
MATKKLCLDYLLLFMPNPQFKMRKVLQDHPEHWTALLGEEKFNSLVGNTPASLYLQAMQT
ILQTLPPSHFPKSIQELPIPQALKPLPSYGKKQS
Download sequence
Identical sequences 9031.ENSGALP00000014703 ENSGALP00000014703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]