SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000019146 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000019146
Domain Number 1 Region: 11-172
Classification Level Classification E-value
Superfamily RUN domain-like 6.93e-40
Family RUN domain 0.00063
Further Details:      
 
Domain Number 2 Region: 1335-1449
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 9.94e-28
Family Supernatant protein factor (SPF), C-terminal domain 0.0017
Further Details:      
 
Domain Number 3 Region: 1141-1205
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.72e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000019146
Domain Number - Region: 979-1070
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000262
Family Myosin rod fragments 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000019146   Gene: ENSGALG00000011737   Transcript: ENSGALT00000019170
Sequence length 1451
Comment pep:known chromosome:WASHUC2:2:42764578:42788947:1 gene:ENSGALG00000011737 transcript:ENSGALT00000019170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAPGESQLQRIIRDLQDSVAELSKEFKEGGEPITDDSVNLQKFSYKLEYLLQFDQKEK
STLLGNRKDYWDYFCDCLAKVKGANDGIRFVKSITELRTSLGKGRAFLRYSLVHQRLADT
LQQCFMNTKVTSDWYYARSPFLNPKMSSDIVGQLYELTDVQFDLASRGYDLDAAWPAFAR
RTLSSLGSSAYLWKPPSRSSSMSSLVSNYLQAPEFPSSPDANNSLNAEHFEGFEEMRVEL
DQAELRQKELQRSIHQLEMENQELQAAVSLQKEQLQLEKEKSNNYSEENSRLTKMITELQ
KQCEVSHSTQSTVHDLQKCLQSLELNAVEQQKEYSTKLAQLATSKEDYASKLQLLNEELE
VSRALVAMKELCIDELKAKLSSMEEKGHQAMAQCDSALQIQALLEKLQQTEKEKAEMQRL
SDECTSQLKTAEEQLRLKEEAQKSLETMEKEVDALQKALTLKEKKMAELQTQVMESLAQV
GSLEKDLEEARKEKEKLKEEYGKMEEALKEEAQSQAEKFEQQEGHLKKVSETVCSLEEQK
RKLLYEKEHLSQKVKELEEQMRQQNSTVNEMSEESRKLKIDEKEKKLRSQNKQLDEDLQN
ARRQSQILEEKLEALQSDYRELKEREETTRESYASLEGQLKGAKQHSLQVEKSLDTLKES
KESLQSQLAEKEIQLQGMECQCEQLRKEAERHRKKAETLEVEKLSAENTCLQQTKLIESL
TSEKESMEKHQLQQAASLELTVSEEQLQVNRDEVSRLQTEVLDLRVKLQQTTDEREQLKS
ELAITETVLGEQKVLVQQLKEQTESLNRNHVQELVQCKEREEVLKREQEAVVLQKTELEN
NLLSLKEELSKFKQYLEAARMENVENKDLLHRTNTDMAELGIQICALSSEKVDAEEQLAQ
AKERLKELEEQAAMQQEKLKHDISNLRQENRSLQEKLEEAQICVSAVPSLQAQLETAKKQ
AQSFQETSQEELSAIKFQMSTEILNYQTKFKTANEECGKLRDQLEEQKRQQHATEEEIAG
LQAENTSLSRKLDEAREQLSELQSARLQKEEEVTSLRELLERTQKEADEAKNQALDYSEK
LSKMAADKDSNDQKLFAELDDLTRTKQFLEERLIELIRDKDALWQKSDALEFQQKLSAEQ
KWQGDTEVNHCLDCQREFSWMVRRHHCRMCGRIFCYYCCNNYMVTKPGGRKERCCKACFN
KPRVIVDNTDDSGSSANQEGSPGSLESPVSPGEKAFGYTVAGEASKPPDDAAFDIITDEE
LCQVQESDSLHSESQMDRDSLDQSVTDLNSTCNSSTFDESEEWQVAQDAEISLLKSGEIM
VKLPLTVEEIMNFGEGNRELFIKSSTYSIIPITVTEIGLTISWIFSSDPKSISFSVVYQE
SEDTPLDQCKVLIPMTRCNSHKETIRGQMKVRNSGIYTLIFDNTFSRFISKRVFYQLTVE
RPVIYDGSDFP
Download sequence
Identical sequences 9031.ENSGALP00000019146 ENSGALP00000019146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]