SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000019669 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000019669
Domain Number 1 Region: 565-591,684-724,881-1127,1176-1217
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.1e-37
Family Tandem AAA-ATPase domain 0.037
Further Details:      
 
Domain Number 2 Region: 7-135
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000351
Family Ankyrin repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000019669   Gene: ENSGALG00000012057   Transcript: ENSGALT00000019695
Sequence length 2477
Comment pep:known chromosome:WASHUC2:2:45996153:46020578:-1 gene:ENSGALG00000012057 transcript:ENSGALT00000019695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTGAKSEIPLQICLKKNYIELVYLLLTKGADPRNISFAKGDTPLHAAVHICLDKRDGTGI
NILNYLLDLFASRPSDFPYLNPNVQDDNGNTVMHVIFQRGFSKQAKRIMDSLAKFDVNFN
IKNKLGRDVRHRIKKNDPLLLAWNTAVSEKKKYRQDIAGQLVKTPKPTPASDVSQPKNAG
RSSSGSLLKVPSGNTARNDVKTQSSVKTKNDQLSKQEMEKIKNPLTMQESLVQEIAALIQ
QLKWGDALRKDNSVVQKQSSGQTNLEEGKSASLQLSGSAVYSEGRGDDREKKKGVQEFSV
GLSNGEKEAPDEETILDIEAYVQEFDNMTWEIECTPEALKTLGSKDVPHYLKTKTIMTIK
RLGNGEWTKGLQKPLKHLKADIQLYEAKLGKGARMLWELAIDFSPRCSESAEKIMETEQT
KSLPEKSGRVYTEMIRIWAIVLDHCKLNRVLDNICLSYNRGLSCILRKKLKGINEGHQNY
NVTMHKRVPRCYVEDLEREKSKEHTIPEYFPPASAAEMEYNIMKFHSFSTNMALNIINDV
HSAVEYPFRVGELEYAVIDLNPKPMEPIILIGRSGTGKTTCCLYRLWKKFYSYWEKSTMA
NSPLLERQTWRQRQCSDVEKARLENEECEEKQDNDDSSEEQVSEEQDQDSEDEEVATGTS
DAETSPCDDHEEGQKCNSEEPNTLEHLHQIFVTKNPVLCQEVQKNFIELSKSSKVTSHFK
PLEPNVHRLQDVKDENFPLFITSKQLLLLLDASLPDPFFPRNEDGSLKRTIVGWSPQEEL
VIPNWQDEDEECNAEAEDGDEERTADGYSRESDPRTFVTYDLFANEIWPKMIKGKSLYNP
ALVWKEIKSFLKGSFEALSCFGGKLTEEQYKKLGRKRSPNFTEDRSEIYHLFCLYQQIRS
QRGYFDEEDLLYNLSQRLSQLGELPWSIHEFYGDEIQDFTQAELALLMKCINDPNSMFLT
GDTAQSIMKGVAFRFSDLRSLFHYASKNTVDKKQRVRKPKRIYQLYQNYRSHSGILSLAS
GVVDLLQYYFPESFDRLPKDCGLFDGPKPTVLESCSFSDLAILLRGNKRKTQPIEFGAHQ
VVLVANETAKEKIPEELSLALVLTVYEAKGLEFDDVLLYNFFTDSEASKEWKIISSYTPD
SDVQVGSKLLIEMPLEDATAMQKRPTSFNAEMYKMLNGELKQLYTAITRARVNLWIFDEN
SDKRAPAFKYFIKRGFVQVVKTDENKDLDDSMFAKTSSPEEWIAQGDYYAKHQFWEVAAK
CYQKGGAAEKSKLALAHDAVLKVHSKKSSPREKQMEYMTLAKTYLECGEPKLSLKCLFQS
KEFRLCAELCKKLGKMKDAAVYYQKNQCYKEASECYEQIEEFDLAIKMYCQEELYEEAAK
AVERYEEMLNARGQMVSKLSCTANQLYLEAAAKYLSVNRIEEMMQVLSKLDIEDQLEFLK
SRGCLHQTADLLKREGRQEEAAKLMKQHGYALEAANLTAIKEFRASCLLAAVRAGTTHCS
ESNLVDREIMLREALELCEQTNQKSGIAEALFLQGAPKRDFTKLSNAYFQFLSVNHSAGA
VEVLFVLSRCSAPSQEILCKATHGLMALLDLVKSLKKATTNVEKDMVKSCFAYFGIIPTG
DSCCQVSQNEAEPILKFLLDKASLKERKTKGNFSVSTEAVKSALKQHLLSRLCSITHELL
NKHYPDICMKFIVGLNCEDSTCGDFHKPLMRHEARMVFQCKMNLAAINGLLLEATHTFPK
ELLSHCKSFDGLLTSDKYVSCKALLETFFPNHFHLRILSENPKACKEILGFSNITSKPCR
ALLNEYISFKFKDEDARARRESSDLWLSAMKVFLLSSGYPEEFEKLLFKEEDDYNRELNL
ALSKAKSSPKSKSHGGKIKGIDGRHGMLQPDKKTENAGRTHLCFIRLLQSSFEQFYVYKN
PESCKRLFFRFMNVLVKKCTRYLIPSIGNTVMLLEFQYIICCAVLMRLNKNVTLCLPKSY
IALVHYWDFLFRNKGRSKEFTETFSIIQEYRPKDILVAEQNFRFHLCYLAKILCGVHENF
SVLLDAFEDPDCVTSGEAERTVVLSLVMILNADQVQNSMCKYLLSQLFPEIKGMLKAMRK
DSPSKVPVRLLKVVEQVAAASGVREVAASLQELLIERDEEYLFDCRWRWDSVYTQGYAPI
RGILYENVNFDRFIASLDKTEYADEIEKELESDQCLEDQKDPLEVIALNKQQKQEQKASA
LRHLYRVFHFVFVCMRWKRKACCKAEPVAVEGEEFLSDIFKKADIDQTQCDLCGVRFIQS
SENYFSQTESVEADTSEAVTPTEEKMQVEGNAIIAASEAYMEHRNTDKHRNNNAAYKNYA
DFFRRWIDPKIRDGLDVVEAITERTYTQDHLAYKEGSNLCQRKIKENIKKISDAVEEIYE
RKAWAEAEEIITEHANKLFAVTDEAYKWLKKMDLQRIKEEDFVHDRDLENEVEDESMAFE
ELAYKKPSRKKGRYGKW
Download sequence
Identical sequences 9031.ENSGALP00000019669 ENSGALP00000019669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]