SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000020058 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000020058
Domain Number 1 Region: 321-376
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000556
Family Ankyrin repeat 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000020058   Gene: ENSGALG00000012292   Transcript: ENSGALT00000020085
Sequence length 383
Comment pep:known chromosome:WASHUC2:4:62339090:62384233:1 gene:ENSGALG00000012292 transcript:ENSGALT00000020085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HTKDILVIYEQEAEEWALYLKSLFGHTVNEEGILLYNLETLSFKRLELFSLSCYKCKLLI
LSYGLLKCLNRKRCCFLAHVLQPPDNVVILLCGVENSDMLYEILTLSGRSREIFTDQEPE
DYLSIVTGIIQADCQPTSHVNLPDARGASEKADLGFETEVLTETLENNEYSVLVLPARIP
CENPGEIFILLKDEIDDETLEIEFIADNQRIRTQPASWNKKVKYMKALDFPAGPVYINVY
CEGVIKTTAQIEYYTAAEEVERIFQKVADPIAFICQFSSVEKLDNILTLLLESNIPLFKL
KHLRASTTFRVRDRHLEEFPTLLHCAARFGLKNLAAVLLKHPEAAKACKISNTDGDVPAS
IAEKHGHKEIRELIKELLSQEEG
Download sequence
Identical sequences 9031.ENSGALP00000020058 ENSGALP00000020058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]