SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000021524 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000021524
Domain Number 1 Region: 67-418
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.09e-64
Family Ankyrin repeat 0.000051
Further Details:      
 
Domain Number 2 Region: 784-843
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000255
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000021524   Gene: ENSGALG00000013196   Transcript: ENSGALT00000021557
Sequence length 863
Comment pep:known chromosome:WASHUC2:2:90134254:90175711:-1 gene:ENSGALG00000013196 transcript:ENSGALT00000021557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGECGVPAQVQLFLRACEQGDCETARRLLGLPGGTAGSAAASACGTEETAEPRGEAAATA
PAPVVAVDCTDEAGNTGLQFAAAGGHEQLVRFLLRKGASVQSTNHYGWSPLMQAARFGHL
SVAHILLENGADLNAQNKLGASVLTMACRGGHVSMVKLLLESGAYVDNYDHFSTNVLNSS
RDDLPDITPLMAAAQHGHEAVVHLLLDWGADCNYTVKTMGWSPLMLAAVSGKVSLAQQLM
EKGANPDHLNVLHKTPFEISVGFKHKDMKDYLESLTTIRIHTDTEKRQPDIFHALKLGNF
QLVKEIVDEDSSQVNITNVDGASPLMIAAVTGQLPLVQLLVEKNADVDKQDNVHGWTALM
QATYHGNKEVVKYLLNQGADVNLRAKNGYTAFDLIMLLNDPDTELVRLLASACMQVDKDK
NKLNNRSSLPSSRSRQSLNVPMLPDDRGGLKSWWSRMSNRFRKLKLTQTLRHGFSSNQFG
PFPDEPESSLNSTMKAVPQSDTDSSGTTDAPMAWVTNNTGVNTAKGGKDDELLTTMLRSS
APFTRLPSDKLKAVIPPFLPPSSFELWNSDRTRISKDGKAEQMRTAWPQRAIKHDFNSSG
NSDVTSVSKGTRPVKLPAFARRPASPSNSTNFNHSPHSSGGSNNIAGINRHGGELHNRSG
GSADNVLSQIAAQRRKAAGLPEQKPSQHNSPVQATPSSTPSDTQCAQTVGNGHVVKVQMN
QKTEMNKRPPSGTSSTSKSTSPTLTPSPSPSPSPKVHNMESSLSSSHRQAKSNGSSSGTI
TEDDELTGILKKLSLEKYQPIFEEQEVDMEAFLTLTDGDLKELGIKTDGSRQQILAAISE
LNAGKGRERQILQETIHNFHSSF
Download sequence
Identical sequences ENSGALP00000021524 9031.ENSGALP00000021524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]