SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000021645 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000021645
Domain Number 1 Region: 24-85,126-183
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.11e-23
Family Ankyrin repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 237-279
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000235
Family SOCS box-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000021645   Gene: ENSGALG00000013271   Transcript: ENSGALT00000021679
Sequence length 282
Comment pep:known chromosome:WASHUC2:Un_random:31516143:31519142:-1 gene:ENSGALG00000013271 transcript:ENSGALT00000021679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWYIMQSVQSKYSLSERLIRTIAAIRSFPRDNVEDLIGRGADVNCMHGTLKPLHCACMVA
DADCVELLLQKGAEVNALDGYNRTCTTRLRRTRPAWRSCWSTEPTPTRWTATRTRRCTGR
PSRTRLSVCAHCWRTAPVNARDYNDDTPLSWAAMKGNLESVSILLDFGAEVRVVNLKGQT
PISRLVALLVRGLGTEREDSCFDLLHRAIGHFELRKNGSMPWEVTRDQQLCEKLTLLCSA
PGTLQTLSRYAVRRSLGVRFLPEAVEQLPLPTCLKEYVLLLS
Download sequence
Identical sequences ENSGALP00000021645 9031.ENSGALP00000021645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]