SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000022680 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGALP00000022680
Domain Number - Region: 127-187
Classification Level Classification E-value
Superfamily RING/U-box 0.000244
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Domain Number - Region: 65-119
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000792
Family PHD domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000022680   Gene: ENSGALG00000014027   Transcript: ENSGALT00000022720
Sequence length 217
Comment pep:known chromosome:WASHUC2:Un_random:3374820:3376293:-1 gene:ENSGALG00000014027 transcript:ENSGALT00000022720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSAVCPLCGRADVDPNVCGHTFFASGIHVHEFCLMFANTISEARPAWVGPESLPVAVVRR
AVRQANQKQCFVCGERGAAITCAESGCERSFHLPCAMDGECITHFFGPRSSYCWEHRPSQ
ESREAPAEGTNCLICLEPVGDSLSYHTMVCPACAHCWFHRGCIQQHALNAGAWCFRCPNC
QDILMFLAEMFLMGIHIPLRRPLWEESDAYESLLERH
Download sequence
Identical sequences 9031.ENSGALP00000022680 ENSGALP00000022680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]