SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000025528 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000025528
Domain Number 1 Region: 140-425
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.79e-54
Family Regulator of chromosome condensation RCC1 0.0073
Further Details:      
 
Domain Number 2 Region: 765-869
Classification Level Classification E-value
Superfamily POZ domain 2.16e-20
Family BTB/POZ domain 0.0091
Further Details:      
 
Domain Number 3 Region: 42-130
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.91e-16
Family Ankyrin repeat 0.001
Further Details:      
 
Domain Number 4 Region: 542-645
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000412
Family BTB/POZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000025528   Gene: ENSGALG00000015864   Transcript: ENSGALT00000025575
Sequence length 1359
Comment pep:known chromosome:WASHUC2:3:80989153:81034982:1 gene:ENSGALG00000015864 transcript:ENSGALT00000025575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKMNSLMPDCTSKCRSLQHALDVISVVTRGSEGQIKAFLSSYCYNAATIKDAFGRNVLHL
ASSCGKKGVLDWLAETKGVDLLAKDKESGWTALHRSIFYGYIDCVLSLLKHGVSLYIQDK
EGLSALDLVMKDRPIHVVFKKTDLTEVYTWGNNINFTLGHGGQQSKHHPELVDLFPRNSV
YIKQVVLCKFHSVFLSHKGQIYTCGHGQGGRLGHGDEQTCLVPRLVEGLSSHQCSQIAAA
KDHTVVLTEDGCVYTFGLNTFHQLGILPPPANCSVPRQVQAKNLKGRMVIGVAAGRFHTV
LWTKEAVYTMGLNGGQLGYLLDPNGEKCVTAPRQVSALHHKDVSVSLVSASDGATVCVTE
RGDIYLLADYQCKKIASKQLNLKKVLVNGGYLEYKVDTQHLKENGGQKICILALDEAGRI
FCWKSSNNSMKQCRWVYGRQVFMSDVALNRNEMMFVTQDGEAFTGKWLEEGRKVLEKKEL
VSSLPNASTEMSCSYDTNNAYERIRLQKLAFVHRAVSVATDPNGCNFAVLQSDPKTSLYE
IPSVSLSSFGEDFGKLLDETDEMDSIHDVTLQIGTRTYAVHKYILAVRSDFFKKLFVSSD
SQLETPDVYRKDEDAVGCDLYVIEKVHPDLFAYLLQFIYTDTCDLLTHGYKPKILHKEKS
EEYQDTLISNLNKMSFDEDVNRKSAFEIYRNNQVQVLNEKQKNKSKKGKIVGGEANLIKM
LQSAAKKFGLSNLSGRLDGVRLENGKINVVNRKNGNKLKFNQKKCSYLCDVTLKSSDGKE
FPCHKCVLCARLDYFHSMLSSSWIEASSCSALEMPIHSDILQIIIDYLYTDEALAIKDSQ
NVEFICNVLVVADQLLISRLKEICEVAIAEKLTLKNAAELLEFSAMYNAEQLKLSCLQFI
GLNMAALLETRTLDVLSDDVVKDLSVYYRKMIPAMVRRVITPYPDGPDLSCFEPEEGENF
VFIREEMNTEQNSQEALFKRAKTKAKKKPRKRSDSSGGYNLSDIIQSPASTGSIKLDKTN
SVESLPELLTSDSEGSYAGVSSPRDLQSPDFTKVFHPERTEMKDKACSLVMKASQQNKEM
KSCKGSSALTQSVPQSIPRTKNSSATSPNWVASSFSPASPPAMDLRTIMEIEENMQKCGT
MPKTNSSRMTSHGIKLSQKQRKMIALAAKDNVSVTTTAEPTPLVTIPPTPTKVAKLGNAW
SSSLHSPLPKSFRDLVMEEEKYMSANNLPGTTIKRAGYKGAEDSPVQSTARCMARSSPGL
EGHVLDSPQLESHNPWLATSPTNSPVMAPVMFASIVEEERQQEAALIRSREKPLALIQIE
ECAIQDLLIHYEAFDNPDEFVTVERAPQGPMATPMWNKH
Download sequence
Identical sequences ENSGALP00000025528 9031.ENSGALP00000025528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]