SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000026250 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000026250
Domain Number 1 Region: 556-705
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.19e-66
Family Ankyrin repeat 0.00000157
Further Details:      
 
Domain Number 2 Region: 33-271,318-343
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.23e-63
Family BAR domain 0.0022
Further Details:      
 
Domain Number 3 Region: 434-551
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.24e-39
Family Pyk2-associated protein beta ARF-GAP domain 0.00000616
Further Details:      
 
Domain Number 4 Region: 309-428
Classification Level Classification E-value
Superfamily PH domain-like 9.18e-21
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 
Domain Number 5 Region: 1067-1126
Classification Level Classification E-value
Superfamily SH3-domain 7.35e-16
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000026250   Gene: ENSGALG00000016302   Transcript: ENSGALT00000026300
Sequence length 1127
Comment pep:known chromosome:WASHUC2:2:146233580:146337761:-1 gene:ENSGALG00000016302 transcript:ENSGALT00000026300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDQITVSEFIAETTEDYNSPTTSSFTTRLQNCRNTVTLLEEALDQDRTALQKVKKSVKA
IYNSGQADHVQNEENYAQVLDKFGSNFLSRDNPDLGTAFVKFSTLTKELSTLLKNLLQGL
SHNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTKIEKEKREHAKQHGMIRTEIT
GAEIAEEMEKERRLFQLQMCEYLIKVNEIKTKKGVDLLQNLIKYYHAQCNFFQDGLKTAD
KLKQYIEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQLDQKEVNNLAVDVKANSLIDD
SQSRQGGYSMHQLQGNKEYGSEKKGYLLKKSDGLRKVWQRRKCTVKNGILTISHATSNRQ
PAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQEYVAWISVLTNSKEEALNMAFR
GEQSTGENSLEDLTKAIIDDIQRLPGNEVCCDCGSPDPTWLSTNLGILTCIECSGIHREM
GVHISRIQSLELDKLGTSELLLAKNVGNNSFNDIMEGNLPSPSPKPSPSSDMTARKEFIT
AKYVDHKFSRKTCASAAAKLNELLEAVKSRDLLALIQVYAEGVELMEPLLEPGQEPGETA
LHLAVRTADQTSLHLVDFLVQNCGNLDKQTALGNTVLHYCSIYNKPECLKLLLRGKPTID
VVNQAGETALDTAKRLKAVQCEELLSQAKAGKLNPHVHVEYEWNLRQEEIDESDDDLDDK
PSPIKKERSPRPQSFCHSSSISPQDKMTLPGFSTPRDKQRLSYGAFTNQIFASTSTDSPT
SPTADAPPLPPRNAGKGDTCPPSTLPLSTQPSSGSSTLSKKRPPPPPPGHKRTLSDPPSP
LPHGPQNKGPVPWGNDLGPPSTKAANKFEGMSQQSSTGTAKTALGPRVLPKLPQKVALRK
IETSHHLSIDKSNQHTEMFKPSLSIDIPQKPQPGDLPPKPLPLELTQKPQVGDLPPKPGE
LPPKPQLGDLPPKPQLGDLPPKPQIKDLPPKPQLGELLAKTQGGEASPKPQPSEANQKSH
SLDLSPNVQSRDTVQKQASEESNDVTHTLPETPVPLPRKINMGKNKVRRVKTIYDCQADN
DDELTFVEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD
Download sequence
Identical sequences ENSGALP00000026250 9031.ENSGALP00000026250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]