SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000028084 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000028084
Domain Number 1 Region: 71-183
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.55e-28
Family Ankyrin repeat 0.001
Further Details:      
 
Domain Number 2 Region: 5-73
Classification Level Classification E-value
Superfamily SH3-domain 3.02e-22
Family SH3-domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000028084   Gene: ENSGALG00000017447   Transcript: ENSGALT00000028137
Sequence length 214
Comment pep:known chromosome:WASHUC2:Z:36405663:36415988:1 gene:ENSGALG00000017447 transcript:ENSGALT00000028137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TNKPPTIPEKPGQVKVFRALYTFEPRTPDELYFEEGDIIYISDMSDTNWWKGTCKGRTGL
IPSNYVAEQAESIDNPLHEAAKRGNLSWLRECLDNQVGVNGLDKAGNTALYWACHGGHKD
IVDVLFTQANLELNQQNKLGDTALHAAAWKGYADIVEMLLAKGARTDLKNNEKKLALDMA
TNAACASLLKKKQTAGTARTLSNAEEYLDDEDSD
Download sequence
Identical sequences ENSGALP00000028084 9031.ENSGALP00000037348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]