SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000028313 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000028313
Domain Number 1 Region: 123-204
Classification Level Classification E-value
Superfamily Immunoglobulin 7.31e-25
Family C1 set domains (antibody constant domain-like) 0.0025
Further Details:      
 
Domain Number 2 Region: 1-110
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 0.0000000000231
Family MHC antigen-recognition domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000028313   Gene: ENSGALG00000017674   Transcript: ENSGALT00000028378
Sequence length 231
Comment pep:known chromosome:WASHUC2:16:289317:291075:1 gene:ENSGALG00000017674 transcript:ENSGALT00000028378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDGDLFGKYDSKIKSAQPIVEKLPQEDQEHWAAQTQKARGGERDFDWFLSRLPERYNKSK
GERGGSCSAMRLGQELCVPRVSANPTDHELGTVCVQNLRYLEHGKAALKRRVQPEVRVWG
KEADGILTLSCHAHGFYPRPIAISWMKDGMVRDQETRWGGIVPNGDGTYHTSAAIDVLPE
DGDKYRCRVEHASLPQPSLFLWEPQPNLIPIVAGAVVAIVAVIAVVVGLVV
Download sequence
Identical sequences ENSGALP00000028313 9031.ENSGALP00000028313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]