SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000029877 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000029877
Domain Number 1 Region: 448-518
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.86e-19
Family PHD domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000029877   Gene: ENSGALG00000008403   Transcript: ENSGALT00000030514
Sequence length 651
Comment pep:known chromosome:WASHUC2:5:26025061:26049965:1 gene:ENSGALG00000008403 transcript:ENSGALT00000030514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNADLKKQLHELQAKITALSEKQKRVVEQLRKNLIVKQEQPDSKFQIQPLAQSENKLQTP
QPQPLQQLQQHHHQQQQQSTAPSPNVIGSQKTVTTASMITTKTLPLVLKAATATMPASVV
GQRPTIAMVTAINNNQKAVLSTDAQNAPVNLQTTNKVTGPGAETVQIVAKNTVTLQVQAT
PQPIKVPQFIPPPRLTPRPNFLPQVRPKPVAQNNIPIAPAPPPMLAAPQLIQRPVMLTTK
FTPTSLPNSQNSIHPVRVVNGQTATIAKTFPMAQLTSIVIAAPGTRLAGPQTVQISKPNV
EKQTIKPHVEAEEKQTESRTVTPPAAPKPKREENPQKLAFMVSLGLVTHDHLEEIQSKRQ
ERKRRTTANPVYSGAVFEPERKKSAVTYLNSTMHPGTRKRGRPPKYNTVLGFGALTPTSP
LSSYPDSPENEKTETTFTFPAAVQPVSLPSPSSTDGDIHEDFCSVCRKSGQLLMCDTCSR
VYHLDCLDPPLKTIPKGMWICPKCQDQMLKKEEAIPWPGTLAIVHSYIAYKAAKEEEKQK
LLKWSSDLKQEREQLEQKVKQLSNSITKCMEMKNTILAKQKEMHSSLEKVKQLIRLIQGI
DLSKPINSEVNSVAISNGMDSTNNTNAATSTLAPSPSQSCMVNCNKGDETK
Download sequence
Identical sequences 9031.ENSGALP00000013674 ENSGALP00000029877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]