SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000030108 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000030108
Domain Number 1 Region: 791-863
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.22e-17
Family PHD domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000030108   Gene: ENSGALG00000006731   Transcript: ENSGALT00000030745
Sequence length 874
Comment pep:known chromosome:WASHUC2:1:4177064:4190962:1 gene:ENSGALG00000006731 transcript:ENSGALT00000030745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRTDPILDDVGDAFKLMGVNLHELEDYIHNIEPVTFAHQIPSFPVSKNNVLQFPQPGSKD
AEERKEYIPDYMPPIVSSQEEEEEEQVPTDGGTSAEAMQVPLEEEGDMEEDEAINDENYL
SKRPLESPDAEEFPPMKRPKLSVSKGDALDGALEPREPLSSINTQKVPPMLSPVHVQDST
DLAPPSPEPPMLAPIAKSQVPTPKTLESKPPAPKTKSKTSSPGQKTKSPKTTPSPVVAGS
PIRSPKTGSKEKKSPGRAKSPKSPKSPKAPVHVPPPPVKPETPSRTPLAALSDKIGKENI
QVKQGQTPPEPVTKPNIENQTKKLPVMDKTIDDSIDAVIARACAEREPDPFEFSSGSESE
GEIFTSPKRLSVSETTATTPKPSVSTNCSNKAGATPVPPSGGTSSSDISWTMDDSIDEVI
RKANMGTPSNPPANFTYFSSPSASPPTPEPLLKVYEEKTKLASSVEVKKKLKKELKTKMK
KKEKQKEKDKEKSKEKNKEKEKNKEKDKDKEGNKEAKFQWKELLKDDEHDPYKFKLKDFE
DADTKVKLKDGNTKKEKEKHKDKKKEKEKGKKDKDKKDKEKVKDKSKEDKIKPPSAPLVL
PPKEMSLPLFSTPTAMRLPSMLPSLSPMLPEKLFEDKEKPKEKKKDKKEKKKKKEREKDK
EKEKKDKEKERKEREKKEKEKEKHKHEKIKVEPVVPAPSPVIPRLTLRVGAGQDKIVISK
VVPAPEAKPATPVSRPKTPPPVPSPVPAPVHVTPPPAPVPAPPQPTVSPALLPPASPAVS
AAGGSKAPVRSVVTETVSTYVIRDEWGNQIWFCPGCNKPDDGSPMIGCDDCDDWYHWPCV
GITAAPPEEMQWFCSKCANKKKDKKHKKRKHRAH
Download sequence
Identical sequences 9031.ENSGALP00000010875 ENSGALP00000030108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]