SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000033738 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000033738
Domain Number 1 Region: 50-166,193-301
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.64e-43
Family Ankyrin repeat 0.0000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000033738   Gene: ENSGALG00000006809   Transcript: ENSGALT00000034380
Sequence length 322
Comment pep:known chromosome:WASHUC2:24:4337175:4345853:-1 gene:ENSGALG00000006809 transcript:ENSGALT00000034380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQYQPASSTLPTPQFVPLPISIPEPAPQELEDARRVIGTLPIEKLLLEDEDNDTILHIYA
AKGMRAFTLAAAERMKELQRLDAKEHRGKTPLLVAVTARQPAIVHDLIQAGADVNAVDNK
GQSALHLAATYGYAQVLQVILSHGQPLDLEMKDFEGHTPLHCAVLAHNTLLRDRGRLALP
EQQSEDLQHQSWELESCVQQLVQAGASIYSRDVKSNKTVLHYTVQDGNVSLLRYFLELNA
FKSKDFINSKAHGNTALHMAAALHGDRNQKEIIQLLLDHGADPSIRNLDNDQPIHMAPSG
KAGDQIRHLLKRGKVASTFIAC
Download sequence
Identical sequences 9031.ENSGALP00000033738 ENSGALP00000033738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]