SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000034039 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000034039
Domain Number 1 Region: 462-722
Classification Level Classification E-value
Superfamily YWTD domain 6.28e-53
Family YWTD domain 0.0000000781
Further Details:      
 
Domain Number 2 Region: 252-292
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000196
Family LDL receptor-like module 0.00051
Further Details:      
 
Domain Number 3 Region: 49-86
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000497
Family LDL receptor-like module 0.0007
Further Details:      
 
Domain Number 4 Region: 167-206
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000288
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 5 Region: 290-330
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000511
Family LDL receptor-like module 0.00052
Further Details:      
 
Domain Number 6 Region: 206-243
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 7 Region: 88-126
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000055
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 8 Region: 125-167
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.0002
Further Details:      
 
Domain Number 9 Region: 416-456
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000729
Family EGF-type module 0.0012
Further Details:      
 
Domain Number 10 Region: 335-372
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000628
Family LDL receptor-like module 0.0004
Further Details:      
 
Domain Number 11 Region: 373-420
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000398
Family EGF-type module 0.002
Further Details:      
 
Domain Number 12 Region: 726-771
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000008
Family EGF-type module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000034039   Gene: ENSGALG00000010166   Transcript: ENSGALT00000034683
Sequence length 865
Comment pep:known chromosome:WASHUC2:Z:27352711:27367721:1 gene:ENSGALG00000010166 transcript:ENSGALT00000034683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSSRQRGDRSAATGGGCGARRWALPRCGALCLLLALGCLRTATDGAKAKCEESQFQCSN
GRCIPLLWKCDGDEDCSDGSDESACVKKTCAESDFVCNSGQCVPNRWQCDGDPDCEDGSD
ESAELCHMRTCRVNEISCGPQSTQCIPVSWKCDGEKDCDSGEDEENCGNVTCSAAEFTCS
SGQCISKSFVCNGQDDCSDGSDELECAPPTCGVHEFQCKSSTCIPISWVCDDDADCSDHS
DESLEQCGRQPAPPVKCSTSEVQCGSGECIHKKWRCDGDPDCKDGSDEINCPSRTCRPDQ
FRCEDGNCIHGSRQCNGVRDCLDGTDEANCNNVIQCSGPGKFKCRSGECIDINKVCNHHG
DCKDWSDEPLKECNINECLVNNGGCSHICRDLVIGYECDCPAGFELVDRRTCGGNDIDEC
QNPGICSQICINLKGGYKCECSRGYQMDLATGVCKAVGKEPCLIFTNRRDIRKIGLERKE
YIQLVEQLRNTVALDADIAEQKLYWADFSQKAIFSASIDTRDKVGTHTRILDNIHSPAGI
AVDWIYKNIYWTDSSAKTISVASLNGKKRKVLFLSELREPASIAVDPLSGFMYWSDWGEP
AKIEKAGMNGFDRQQLVTTEIQWPNGIALDLVKSRLYWLDSKLHMLSSVDLNGQDRRLVL
KSHMFLPHPLALTIFEDRVFWIDGENEAVYGANKFTGAELVTLVNNLNDAQDIIVYHELV
QPSGRNWCEENMVNGGCSYLCLPAPQINEHSPKYTCTCPAGYFLQEDGLRCGGFNISSVV
SEVAARGAAGAWAVLPILLLVTAALAGYFMWRNWQHKNMKSMNFDNPVYLKTTEEDLTID
IGRHSGSVGHTYPAISVVSTDDDML
Download sequence
Identical sequences 9031.ENSGALP00000016512 ENSGALP00000034039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]