SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000035506 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000035506
Domain Number 1 Region: 86-147
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000259
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.058
Further Details:      
 
Domain Number 2 Region: 351-412
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000528
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000035506   Gene: ENSGALG00000001849   Transcript: ENSGALT00000036284
Sequence length 2573
Comment pep:known chromosome:WASHUC2:12:2324534:2368903:-1 gene:ENSGALG00000001849 transcript:ENSGALT00000036284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPTVGPGPGESGKRSSPWGARGLPGKRPPGSESPREMRGRGQAEGPRRTLQVDPHGQRAG
RSPSASPERGSTPTSPYSLPQIAPLPSSTLCPICKTTELTSAPSQPNFNACTQCHSKVCN
QCGFNPNPHLTEVKEWLCLNCQMQRALGMDMTTAPRSKSQQQLHSPSPSPSHSPAKLPAG
QEKTPAPTQPSARPGTAATAVPPPEPPKAQSAAPQREQHGQPKAAAPPEAARASPQHQQA
KPSSSEQRKALGDPKPAAPAPGAGAAEQPQEGLTGKLFGFGASLLTQASTLMSVQPEAPA
PSPQASGKVPPKIVFSDASKEAGPKAGGAQGRVGAAKASKAEPGVKPKEVPKARVLCPLC
KAEINVGSAEPPNYNACTSCRQQVCNMCGFNPAPHLVEKNEWLCLNCQTQRLLEGSLADP
APMPLPAPKQPTSGSPRHQPTAATQRAAAPAEPAAPPKQQPSPARSLWAPEQSRAPSPAP
EKKPPVPAEEKPLPKAAPEPSVPVPKGKSVSPKPEGESKEGRAAPEAQRAKELEDAGKPY
PPDLSRSPQSLSDTGYSSDGISSSQSEITGLVQQEEEKLSGTGLAGQSPPSPSELYKLES
SIRPLLEVRGTPAEPSKGSETREEQRQRQRPRYLSTPEAFDSDEELEDILEEDEDSLEWE
NQREQRESVESSDEFGSKLRHDYVEDSSEGGFSPVPGRPKGREEVADEEFMRRQILEMSA
EEDNLEEEEEEGYGRSKYSVQKAEAEKGKEPSPAKRRLPHGPGGLYKEERKELEAAESED
MSTTQGGLRRFKTIELNSTTGYGREMEVSQEADAGLEREPELEMESLTGSPEERSRGEYS
STLPATTPSYTSGTSPTSISSLEEDSDSSPSRRQRLEEVKQQRKARHRSHGPLLPTIEDS
SEEEELREEEELLREQEKMREVEQQRIRSTARKTKRDKEELRAQRRRERSKTPPSNLSPI
EDASPTEELRQAAEMEELHRSSCSEYSPSIDSEAESFDAVTSKLYKSGSEYNLPTFMSLY
SPTEKVESVQPASKPLKSAEEAYEEMMRKAEMMQKQQVQQAQQDVSYGSTYQQVGYRSTE
GQNGFQYQYADEYGYDSGPTRSSQPDYSSSLSKPGAVYEEILQTSQSIARMHQSSSFDLA
LEKGDKKKGQEEPYQEKHFLNAESAYAELMKQNGGPLTPGTSPTQLSAPVSFSTSEGSKV
VPDVRVTQHFAKEGQDLAKLQSTPSAPSPTSKPITAPYTYSKGTSAVTMAAASPASTPRI
YSSAEAASTPARSYSPAKSTISYGSQTEDITRSKVGVETSVQTAREKLQAVSDGKPPPAK
TYSFFKSSSPPLSPTSPTQSPTHAAPRAAAPSGPTAKSTAEFSTQTQSPLLAYDVPTTTG
PSASSPMVAQGTQTPHRAGSPRLTRQQSSQDAPFMLITLAADAASQTKPPSSSASPVSSP
TRISRQVIAHGYGQEPEQPLATFIRAQHVKDPAQKVPVTSGPDGITGLYSWGALPAENIS
LCRISSIPGTSRVEPGPKVPSSSAVDLRTALKSAPIIITDQGMDLTSLATEARKYCLTLD
QIPSRQSTAIQPLIINLNAQEQPHAIIAASSTTSLAIASPMLISQPKQPVVYGDPFQSRM
DFGQGAGSPVCLAQVKQVEQGVQTGAGRASGTAGPAPTSKPEPPAPPQAKFSRYSLPSQM
VKKDVLITQTSVAHSVSGLQQPFQQEQGSELYRAVPVELKTQSPLLALGGKKSQVMMVQV
EDVAAGPVTKVLKEEPPANVLDLTGVKAESQVACCDVVYKFPFGSSCTGAFNPTSKVPKK
KAADTVPSRKASGPLYGSREPEMPETFPYREQPAPALYEENKFYPTGAFGRLYSSMSDTN
LSEIGMNYYPPKGDQPFHEAAVDLSTMKHSYSIGFAEGGYLGQGLQYGSFSDLRQPADLL
GHPLPMRRYSSASNIYSDYRYSPRGDLASFQESSLAHYSATTAREISRMCAALNSMDHQY
GARHANGPDTMSYGPGGGGLPAQPGGAAAPKPSGMFNPSVPETRQGFSGLAQYNVPGVRL
GAVRQMFPSSATVRAADGMIYSTINTPIASTLPITTQPASVLRPMLRGLYRPYGPPGMAA
VPLASLARVPVVAPRVPLAPQGLYRYPAPSRLPASSLMETPVYLGKAVSAAPGTGPAAKA
PAAPATGVQRAEVSGAAPRTEPPAAGSKEGGQAAPAPKLASESVQREEREREEERQRKQQ
EHVLQLERERVELEKLRQLRLQEELERERAELQRHREKEQLLVQRERQELQCIKQQVLQQ
QQRGESLACQTEPEPPPQPGIVVPQLTVPTTITPYSTNMQMVSTGPLDPHAVRQQTLGKF
EKKKPDPLEIGYQSHLPADSLSQLVTRQPPRSPQVLYSPVSPLSPHRLLESSFATSERLN
KAHVPPQKHFTDSAQRQQTLPRPIKTMQRSLSDPKPISPTSEEASKDRFSLYQHPLLPGT
QVGTLQSSPLARKVKRTLPSPPPEEPHVALGSPATQQLYLGSLAPKAPAAAPVTKASLLK
ELDRDLKLVEHESTKLRKKQAELDEEEKEIDAKLKYLELGITQRKESLLKDRG
Download sequence
Identical sequences 9031.ENSGALP00000035506 ENSGALP00000035506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]