SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000037480 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000037480
Domain Number 1 Region: 14-179,385-451
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.21e-54
Family Ankyrin repeat 0.0000735
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000037480   Gene: ENSGALG00000023277   Transcript: ENSGALT00000038274
Sequence length 535
Comment pep:known chromosome:WASHUC2:10:21322285:21324494:1 gene:ENSGALG00000023277 transcript:ENSGALT00000038274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLSLFQPSFHNLLSLFSFVIDGATALWCAAGAGHFEVVKLLVSHGANVNHTTVTNSTPLR
AACFDGRLDIVKYLVENNANISIANKYDNTCLMIAAYKGHTDVVRYLLEQHADPNAKAHC
GATALHFAAEAGHLEIVRELVKWKAAMMVNGHGMTPLKVAAESCKADVVELLLAHAGCNR
RSRIEALELLGASFANDRENYDIMKTYHYLYLAMLERYRDSENIIEKEVLPPIEAYRNRT
EXILGSDNIDVSHPIIYRGAVYADNMEFEQCIKLWLHALHLRQKGNRNTHKDLLRFAQVF
SQMIHLNEPVKAKDIESVLRCSVLEIEQGMSRIKTTQDADIHTAVDNYECNIFTFLYLVC
ISTKTQCSEEDQSRINKQIYNLIHLDPRTRDGSTLLHHAVNSSTPVDDFHTNDVCSFPNA
LVTKLLLDCGADVNAVDNEGNSPLHLIVQYHRPISDFLTLHSIIISLVEAGAHTDMTNKQ
KKTPLDKSTTGVSEILLKTQMKLSLKCLAARAVRIYNISYQNQIPRTLEEFVKFH
Download sequence
Identical sequences 9031.ENSGALP00000037482 ENSGALP00000037480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]