SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000037487 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000037487
Domain Number 1 Region: 488-575
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000187
Family Ankyrin repeat 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000037487
Domain Number - Region: 59-102
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0799
Family variant C2H2 finger 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000037487   Gene: ENSGALG00000011332   Transcript: ENSGALT00000038281
Sequence length 716
Comment pep:known chromosome:WASHUC2:7:23771737:23773638:-1 gene:ENSGALG00000011332 transcript:ENSGALT00000038281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGGWAGPMSAPESRSVFQAALDPVLLHGLSLVSGFAANPSAAEPAPAGHEKPAATRGGEK
AGTVPEVPERMCCLTCGQEFSSREEQTEHYRLDWHRFNLKQRLRGRRALPVEEFEEKSRA
GDISSISGSDSESSDASSESESPPPASNNPATSQHPRSHKVLLRNARGQLISAYRCILST
GKGGSEEPEELIASLQSLSASTCWVVLMMGGGHFAGAVFRGSQVQEHKTFHRYTVRARRG
TAQSLRDAQTPGSAPRSAGASLRRYNEAALLKDIQDLLAAWAEHLKEAQRIFLRAPRHNR
ALLFDSRNPHISRGDPRVCHIPLSTRRATLREVLRVHAALSSLQVFGKDTPLEDITGSPR
KVWQKKQRAAETDSLQVDTGGDFKHVEGEAPSAPDEEEEEEEEESPAGELETVEVTLGTL
DLREFEVMPKRNRKRRKKRNKKMENGLHAKETGCCGTQGGQPSLELVTELQGKPGAEPLP
WETAGDPQTQLRDALFTACKTGDVGTLRHLLDEQPLDLPHSLLNQPLDEHGFTLLHVAAR
AGRAEAVCLLLEAGADPALRDRQERTPYCVSADKPTRNAFRKFMVDHPDKYDYSRAKVPG
PLTLEMEAKKLEKKRAQKAQRKQREQAQQEERQRLEQEQEEKQQFAALSDREKRALAAER
RLAEQMKNGSTALSNISRCWYCGESLLGRIPFHYLDFSFCSTTCLQTHRRARASHT
Download sequence
Identical sequences 9031.ENSGALP00000018470 ENSGALP00000037487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]