SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000001347 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000001347
Domain Number 1 Region: 3-97
Classification Level Classification E-value
Superfamily Immunoglobulin 6.29e-22
Family I set domains 0.0095
Further Details:      
 
Domain Number 2 Region: 108-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000376
Family EGF-type module 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000001347   Gene: ENSGALG00000000917   Transcript: ENSGALT00000001349
Sequence length 586
Comment pep:known chromosome:WASHUC2:13:1157885:1168257:-1 gene:ENSGALG00000000917 transcript:ENSGALT00000001349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVPPKLKKLKSPNVHVGEKISLKCEATAGNPQPSYKWFKDGKELKKSKDIRIKYGNGKKI
SRLQFNKVKLEDAGEYSCEAENILGKDTAKGSLNVRSVTTTLSSWSGHARKCNETAKSYC
VNGGVCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQTLAEHLGFELKEAEELY
QKRVLTITGICVALLVVGIVCVVAYCKTKKQRKQMHNHLRQNMCHAHQNRSLANGPSHPR
LDPEEIQMADYISKNVSATEHVIRRETETTFSGSHSCSPSHHCSTATPTSSQRHESHTWS
LERTESLTSDSQSGIMLSSVGTSKCNSPACVEARARRGAAFCIEDSRRPTTQYRDSVDSL
RDSPHSERYVSALTTPARLSPVDFHYSMAAQVPTFEITSPNSAHAVSLPPAAPVSFRVEE
QQPLLRRYQLPFQDTQRYDSYYQRKTYLNDSMGSLPSSPFRITEDDEYETTQEYVTALEQ
PKKTASSNRRWKKSKLNGHVPHRARAVRDSFSFSSASYSESDEELVAESTPFLSTQNNEA
TNTESPPLHRPGDSRTQHPYSRHSAHGGSGRSSLAHTTPKREPDPL
Download sequence
Identical sequences 9031.ENSGALP00000040476 NYSGRC-IgSF-XR_026887 ENSGALP00000001347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]