SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000001998 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000001998
Domain Number 1 Region: 65-574
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 4.59e-188
Family Myeloperoxidase-like 0.0000000000000817
Further Details:      
 
Domain Number 2 Region: 24-61
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000463
Family EGF-type module 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000001998   Gene: ENSGALG00000001314   Transcript: ENSGALT00000002000
Sequence length 595
Comment pep:known chromosome:WASHUC2:17:9474724:9478847:1 gene:ENSGALG00000001314 transcript:ENSGALT00000002000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGSSKVPNAVAPRVDGDLSSLSAVNPCCYYPCQHQGVCVRVGLEGYECDCTRTGYFGANC
TSPELWTRLRDLLKPSPTFYHFVLTHFRWFWDIINSTFIRDTLMRLVLTVRANLIPSPPT
FNSQYGYISWEAYANVSYYTRILPPVPEECPTPMGTKGKQQLPDAQLLAQRFLLRHKFEA
DPRGTNLMFAFFAQHFTHQFFKTSGKMGRGFTKALGHGVDLGHLYGDNLQRQHQLRLFQD
GKLKFQVVNGEVYPPSVTEVPVHMVYPPAIPKEKQLAMGQEVFGLLPGLCMYATLWLREH
NRVCDILKQEHPTWGDEQLFQTARLILIGETIKIVIEDYVQHLSGYFLNLKFDPELLFEQ
QFQYRNRIAVEFNQLYHWHALMPDSFTIQGQEYSYEQFLYNTSMLMDYGVEALAESFSMQ
TAGRIGGGQNINANVLGVAVGVIEESRQLRLQPFNEYRKRFGLKPYTSFQELTGEEDKAA
ELEELYGDIDALEFYPGLLLEKPQPNGIFGESMVEIGAPFSLKGLLGNPICSPEYWKPST
FGGATGFEIVKTASLEKLVCLNVKKCPYVAFHVPDAAAAGETDSGHAGGASSTEL
Download sequence
Identical sequences ENSGALP00000001998 9031.ENSGALP00000034260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]