SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000003589 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000003589
Domain Number 1 Region: 436-648
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-30
Family Laminin G-like module 0.006
Further Details:      
 
Domain Number 2 Region: 663-862
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.03e-25
Family Laminin G-like module 0.0086
Further Details:      
 
Domain Number 3 Region: 884-1084
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-25
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 4 Region: 71-203
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000863
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 5 Region: 1270-1309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000175
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 6 Region: 198-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000411
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 7 Region: 1113-1154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000511
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 8 Region: 1110-1225
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000204
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 9 Region: 41-84
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000041
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 10 Region: 1240-1273
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000786
Family EGF-type module 0.015
Further Details:      
 
Domain Number 11 Region: 371-412
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000031
Family EGF-type module 0.0089
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000003589
Domain Number - Region: 308-373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00142
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 235-259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0054
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 4-30
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00956
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 898-932
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0132
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000003589   Gene: ENSGALG00000002287   Transcript: ENSGALT00000003596
Sequence length 1378
Comment pep:known chromosome:WASHUC2:8:2498842:2561808:-1 gene:ENSGALG00000002287 transcript:ENSGALT00000003596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRNDSRCLSNSCQKNSTCITGHRDDICRCVDMSLDTMEELCNKTSDPCSSNPCLQNATCL
SSAGNLNFTCECPDGYNGTTCEIAISMCDTNPCEHGGTCLDGLARPTCLCRTGFTGTRCE
MDVDECSSEPCHNGAVCRDGIDEYSCYCVPGYQGKHCDLEVNECVSDPCLNGATCLNLIG
RYYCICPLGYTGVNCELEVDECQSRPCQNGATCRDAPAAFSCSCPPGFLGALCQTDVDEC
ASGPCLHGALCADRPGGCAWGRGGERAEGGHMEQQLLMQNYLQPIHKSINEENSGSFPSP
LALAGYTGSHCETDISECSSAPCASGRCLERSWAARYGHEPALQLPFRHDRAEGYVCACP
PGIRGIHCDEDINECHTNPCQNGGICENFPGNYTCHCPPADKEGIFYGGWNCTEILRGCT
DQQCQNNGICIPHLKNGHHGFSCICSPGYTGIHCETVTTFSFQGNGFLWLKNPTTTKEES
SYNINLRFQTVQPTAFLFYRGEKDTFVKLELLNGYLHLSVQVKNQPRALLHISHNVSDGE
WHSVEVTLARAVTLNLLDSSCAESCVNKTSAMIDNDHVRLAFQSTFLGSLPVGNISSSSQ
LNINNIHSTPSFVGCLQDIEIDLNVITPENASPESSLNVEAGCRKKDWCENHPCQNRGRC
SNLWLSYHCDCYRPYAGPSCAAEYIPGRFGSEDSSGYAAFSVDATENENLNISMFVRTRK
SSGLLLALRNSTSLYVRVYLEGGKLAMLAPNSIKLLGKHPINDGNFYLITLKIEPNMLEL
FQSSQYLGFISTPVLTTQSKDFLYVGGLPDNRETDRNGGYFKGCIQDVRVNNQPLEFFSL
TNSLNSFINRTLINVTQGCSGDNLCKSSPCHNGGVCYSIWDDFTCTCPPNTAGKACEEVK
WCELGPCPHEAQCKLAHQGFECLANAVFSGRSSAIFYRSNGNIGRGLTNIVFGFRTRDKN
VILLYAEKEPEFVIISIHNSKLVFQLQSGNNFYMLTLTSSLTVSDGKWHQVTVSMVEPLS
QFSRWHMNIDNKDAATSTTATGSLNFLREETDIHLADKAFDNLDGLRGCMSTIEISGIYL
SYFENADILTKKPQEEQFLKISANPVLTGCLQEDACSSEPCMHEGTCEDLYTSYRCTCRP
GWVGTHCETNIDECFSNPCIHGNCTDGINSYECICEPGYTGLNCEEDIDYCQGHQCANGA
TCIDGINGYSCLCAGNFTGKLCRYRRLPYTVCGNEDRNLTCYNYGNCTDLGGKLACVCLP
GFAGERCEKDIDECSSDPCLNGGLCQNLLNKFHCLCDVNYAGDRCEIDLTTDLISNVFTS
LGSVTLALLILFLAVVVSVIAANKRSTQGTYSPSRQEKDGARVEMWSMVQPPPIERLI
Download sequence
Identical sequences 9031.ENSGALP00000003589 ENSGALP00000003589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]