SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000004067 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000004067
Domain Number 1 Region: 177-442
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.95e-84
Family Nuclear receptor ligand-binding domain 0.000000000371
Further Details:      
 
Domain Number 2 Region: 73-155
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.77e-27
Family Nuclear receptor 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000004067   Gene: ENSGALG00000002588   Transcript: ENSGALT00000004076
Sequence length 443
Comment pep:known chromosome:WASHUC2:26:3920818:3937442:-1 gene:ENSGALG00000002588 transcript:ENSGALT00000004076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQLQEEVPEVREEEEEEEEAVTVPSGASDPSAGPDSSLPSSSYTDLSQSSSPSLSDQLQ
MGCEETASGALNVECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQK
KNRNKCQYCRFQKCLSLGMSHNAIRFGRMPEAEKRKLVAGLTASEISCQNPQVADLKAFS
KHIYNAYLKNFNMTKKKARGILTGKASSTPQPFVIHDMDTLWQAEKGLVWKQLVNGIPPY
KEIGVHVFYRCQCTTVETVRELTEFAKSIPSFIGLYLNDQVTLLKYGVHEAIFAMLASIM
NKDGLLVANGNGFVTREFLRSLRKPFNEIMEPKFEFAVKFNALELDDSDLSLFVAAIILC
GDRPGLMNVKQVEEIQDNILRALEFHLQSNHPDAQYLFPKLLQKMADLRQLVTEHAQLVQ
KIKKTETETSLHPLLQEIYKDMY
Download sequence
Identical sequences F1NHW8
9031.ENSGALP00000004067 ENSGALP00000004067 XP_015154374.1.86415 XP_015154375.1.86415 XP_015154376.1.86415 XP_015154377.1.86415 XP_015154378.1.86415 ENSGALP00000004067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]