SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000004130 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000004130
Domain Number 1 Region: 171-442
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.03e-83
Family Nuclear receptor ligand-binding domain 0.00000000111
Further Details:      
 
Domain Number 2 Region: 118-199
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.28e-31
Family Nuclear receptor 0.00000886
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000004130   Gene: ENSGALG00000002626   Transcript: ENSGALT00000004139
Sequence length 448
Comment pep:known chromosome:WASHUC2:17:8010633:8034202:1 gene:ENSGALG00000002626 transcript:ENSGALT00000004139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNSPTSRGPMATPSLHPSIGPGIGSSLGSPGQLHSPISTLSSPINGMGPPFSVISSPMGP
HSMSVPSTPSLGFGTSSPQLNSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGTMASFTKHI
CAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQK
CLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVEKILEAELAVEPKTETYIEANM
GLTPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFS
HRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIV
LFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPDQPGRFAKLLLRLPALRSIGLKCLE
HLFFFKLIGDTPIDTFLMEMLEAPHQMT
Download sequence
Identical sequences 9031.ENSGALP00000004130 ENSGALP00000004130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]