SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000004154 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000004154
Domain Number 1 Region: 4-122
Classification Level Classification E-value
Superfamily C-type lectin-like 7.52e-30
Family C-type lectin domain 0.00000548
Further Details:      
 
Domain Number 2 Region: 162-227
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.03e-16
Family Complement control module/SCR domain 0.00094
Further Details:      
 
Domain Number 3 Region: 538-605
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.38e-16
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 4 Region: 408-481
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.67e-16
Family Complement control module/SCR domain 0.00099
Further Details:      
 
Domain Number 5 Region: 224-289
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.7e-16
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 6 Region: 465-530
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.83e-16
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 7 Region: 286-351
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000208
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 8 Region: 594-658
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000181
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 9 Region: 348-413
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000403
Family Complement control module/SCR domain 0.0035
Further Details:      
 
Domain Number 10 Region: 124-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000148
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000004154   Gene: ENSGALG00000002643   Transcript: ENSGALT00000004163
Sequence length 726
Comment pep:known chromosome:WASHUC2:8:3730893:3737709:1 gene:ENSGALG00000002643 transcript:ENSGALT00000004163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGAWTYNYSEKDYEWDEARAYCKTFFTDLVAIQNKQEIEYLNRTLPYHNKYYWIGIRKQK
GTWTWVGTNKTLTKEATNWAAREPNNRGSNQDCVEIYIKRPSEAGKWNDEPCTKKKKALC
YKASCQPLLCGLHGDCVEVIQSYKCECHPGFEGDNCENAVTCPVLSAPEHGELNCSHLHG
NFTFNSTCDFSCQPGFELTGPQSRECTAVGNWTGEIPRCKAISCPVLSAPEHGELNCSHL
HGSFTFNSTCDFSCQPGFELVGSQSRECTATGNWTGDTSRCKAVTCPVLSAPEHGELNCS
HLHGNFTFNSTCDFSCQPGFELAGPQSRECTAMGNWTGDTTQCKAISCSVLRAPEHGELN
CSHLHGNFTFGSMCNLSCQPGFELLGPQSRKCMPTRAWTGDTSRCKAVTCPVLSAPKHGE
LNCSHLHGNFTFNSTCDFSCQPGFELTGPQSRECTAVGTWSKDTPRCKAVTCPVLSAPEH
GELNCSHLHENFTFGSTCDFSCQPGFELLGSQSRECTATRTWTRESPQCKGRAAAISCSL
LSAPEHGELSCFHLYENFTFGSVCDFSCQPGFELIGPQSRECTATGTWTGNTSQCQAVSC
PVLDVPSHSHLSCSNLHGNFTFNSTCTFSCKEGFIRVGAEMLRCAATGNWTRHPPVCEED
SAFLKQVLVYTSTSALAAAGLVLSGTLIVLLVKQLSNREEKKKLLSPTSDLGAPGIFTNA
AYDSTL
Download sequence
Identical sequences ENSGALP00000004154 9031.ENSGALP00000004154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]