SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000004822 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000004822
Domain Number 1 Region: 32-501
Classification Level Classification E-value
Superfamily Sema domain 9.55e-164
Family Sema domain 0.000000000686
Further Details:      
 
Domain Number 2 Region: 504-556
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000353
Family Plexin repeat 0.0011
Further Details:      
 
Domain Number 3 Region: 566-625
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000107
Family I set domains 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000004822   Gene: ENSGALG00000003058   Transcript: ENSGALT00000004831
Sequence length 628
Comment pep:known chromosome:WASHUC2:28:2781352:2788906:1 gene:ENSGALG00000003058 transcript:ENSGALT00000004831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESQAMGGTAVVLCLILQLTQEVKASVGNCIPRKTVKYQTVSVEMFVKEGLSNVSTLLVDE
ETDTLFVGGRDVISALDLNNVSREIAREHWFATQERQLECIRRGKDKIRCQNYILLLHKI
NDSNVYVCGTNAYHPLCDHMVIQRTKMHLQGRAEESRGKCPFEPTLKYASVFVDGAFYSA
TSNNFLGTEPIILRSMQNPVRTEFKTSWLNEPSFVGMEIVPESEFSPDGDDDKIYVFFTE
TAVEFEFYDKILVSRIARICKGDLGGKRLLQRRWTSFLKARLSCSIPELNFHFNIIQDVF
FLRRGKWQDSIFYGIFSQQWGRLDISAVCAYSMASIQEAFSKGSYRGPVTVEHSHVRWMV
FRGEVPVPRPGACIDNFARNMGYNTSSDLPDKVLQFARDHPLMDSSVNPIGDRPALLKRS
SNYTRIVVDRVTGLDKQTYDVMFLGTDDGYLHKAFNCNGEMFIVEELQLFLSPEPVQFLQ
LSAKKGMLYVGSMSAVVQLQVSGCHRYKYCLDCILARDPYCAWSQASHACVLLSDQTGDT
KNLIQNVKYGDASSCLSVENDVRKYLFTLGNNVHLKCVPLSNLARVVWKFNGSRIQDKDS
KYLLYDGGIAIFNVTVAETGFYDCLSVE
Download sequence
Identical sequences 9031.ENSGALP00000004822 ENSGALP00000004822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]