SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000005183 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000005183
Domain Number 1 Region: 533-748
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-104
Family Thrombospondin C-terminal domain 0.0000000992
Further Details:      
 
Domain Number 2 Region: 406-531
Classification Level Classification E-value
Superfamily TSP type-3 repeat 5.36e-35
Family TSP type-3 repeat 0.00000342
Further Details:      
 
Domain Number 3 Region: 339-408
Classification Level Classification E-value
Superfamily TSP type-3 repeat 2.48e-16
Family TSP type-3 repeat 0.00013
Further Details:      
 
Domain Number 4 Region: 28-72
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 0.00000000000000353
Family Assembly domain of cartilage oligomeric matrix protein 0.0003
Further Details:      
 
Domain Number 5 Region: 268-349
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000222
Family TSP type-3 repeat 0.00029
Further Details:      
 
Domain Number 6 Region: 119-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000429
Family EGF-type module 0.024
Further Details:      
 
Domain Number 7 Region: 172-215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000158
Family EGF-type module 0.018
Further Details:      
 
Domain Number 8 Region: 227-269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000916
Family EGF-type module 0.084
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000005183
Domain Number - Region: 85-130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000178
Family EGF-type module 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000005183   Gene: ENSGALG00000003283   Transcript: ENSGALT00000005192
Sequence length 761
Comment pep:known chromosome:WASHUC2:28:2889957:2905292:1 gene:ENSGALG00000003283 transcript:ENSGALT00000005192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISALAFVFLLCLSCPFSSCQQRRAGIEVGPEMLEEMRETNRVLMEVRDLLKQQIKEITF
LKNTVMECDACGMRPEVTGPVITVTQFNRCVPNPCFPGVACTETSTGFRCGPCPPGYSGN
GSQCTDINECSANPCFPKVQCINTAPGFRCDPCPPGFTGQMVEGVGLAYARANKQVCTDI
NECETGAARNCVPNSICINTRGSYKCGACKPGFVGDQITGCKSQTGRLCPNGQVSPCHEK
AQCIVERDGSISCACLVGWAGNGYICGKDTDIDGVPDEKLRCSDKKCRKDNCMTVPNSGQ
EDADRDGIGDACDDDADGDGILNAEDNCVYTRNADQRNADKDNFGDACDNCRLVKNDDQR
DIDGDGKGDECDDDIDGDGISNARDNCRRVPNPDQKDSDGDGVGDICDSCPTVSNPDQKD
TDHDLVGDVCDTNQDSDGDGHQDTRDNCPSVPNSSQVDTDNDGLGDECDDDDDNDGIPDE
KPPGPDNCRLVPNPGQEDSDGDGVGNLCEDDFDRDMVIDRIDVCPENAEVTLTDFRAFQT
VVLDPEGDAQIDPNWIVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTATDDDY
AGFIFGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSKTGPGEYLRNSLWH
TGDTTDQVKLLWKDPRNSGWKDKTSYRWFLQHRPQVGYIRARFYEGPEVVADTGVVLDTT
MRGGRLGVFCFSQENIIWSNLRYRCNDTIPEDYETFKVQQD
Download sequence
Identical sequences E1C8N1
ENSGALP00000005183 XP_015155618.1.86415 XP_015155619.1.86415 XP_015155620.1.86415 XP_418238.2.86415 9031.ENSGALP00000005183 ENSGALP00000005183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]