SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000005377 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000005377
Domain Number 1 Region: 193-461
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.1e-84
Family Nuclear receptor ligand-binding domain 0.00000000331
Further Details:      
 
Domain Number 2 Region: 140-221
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.97e-31
Family Nuclear receptor 0.00000988
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000005377   Gene: ENSGALG00000003406   Transcript: ENSGALT00000005387
Sequence length 467
Comment pep:known chromosome:WASHUC2:8:5341177:5358233:1 gene:ENSGALG00000003406 transcript:ENSGALT00000005387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYGNYPHFIKFPAGFGNSPVHASSTSVSPSSSLSVGSTVDGHHNYLEAPTNASRALPSPM
NTIGSPVNALGSPYRVIASSIGSHPVALSSSAPGMNFVTHSPQLNVLNNVSSSEDIKPLP
GLPGIGNMNYPSTSPGSLAKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCR
DNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRSRERSENEAESTSGGSEDMPV
ERILEAELAVEPKTEAYSDVNTESSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLE
DQVILLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVS
KMKDMQMDKSELGCLRAIVLFNPDAKGLSSPSEVESLREKVYATLEAYTKQKYPEQPGRF
AKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQVT
Download sequence
Identical sequences A0A1D5PVE2
ENSGALP00000005377 9031.ENSGALP00000005377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]