SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000006113 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000006113
Domain Number 1 Region: 814-867
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000502
Family Laminin-type module 0.00066
Further Details:      
 
Domain Number 2 Region: 271-329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000146
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 3 Region: 921-962
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000123
Family Laminin-type module 0.0098
Further Details:      
 
Domain Number 4 Region: 870-918
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.0015
Further Details:      
 
Domain Number 5 Region: 431-478
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000781
Family Laminin-type module 0.007
Further Details:      
 
Domain Number 6 Region: 711-761
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000106
Family Laminin-type module 0.0061
Further Details:      
 
Domain Number 7 Region: 759-816
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000151
Family Laminin-type module 0.00068
Further Details:      
 
Domain Number 8 Region: 327-385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000307
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 9 Region: 383-433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000474
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 10 Region: 969-1015
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000949
Family Laminin-type module 0.044
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000006113
Domain Number - Region: 86-160
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00374
Family CBM4/9 0.078
Further Details:      
 
Domain Number - Region: 1324-1439
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00811
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.017
Further Details:      
 
Domain Number - Region: 674-713
Classification Level Classification E-value
Superfamily EGF/Laminin 0.01
Family Laminin-type module 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000006113   Gene: ENSGALG00000003852   Transcript: ENSGALT00000006123
Sequence length 1444
Comment pep:known chromosome:WASHUC2:17:6681370:6695065:1 gene:ENSGALG00000003852 transcript:ENSGALT00000006123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NPAMARLRALALLGVVLATAGSSPCYDPRGQPRRCMPVFENAAFGRVPLVSNTCGSPPED
YCLQMGARDASQLCQRCDAADPLLHHNASFLTDFHSQEESTWWQSQSMAFGIQHPNSVNI
TLHLGKSYEITYVRLKFHTSRPESFAIYKRSRADGPWVPFQFYSASCEKTYRKRQRQYLQ
PGENEQVAFCTDEFSDISPLSGGNVAFSTLEGRPSAYNFDGSPTLQEWVTVTDLLISLNR
LNTFGDDIFKDPKVLQSYYYAISDFSVGGRCKCNGHASECAPDEAGRLVCVCEHNTAGTD
CQHCQPFYQDRPWARGTAEAANECLPCDCSGRSEECFYDAELFRRTGRGGHCRNCRDNTA
GPRCEQCRQNHYRWEQQAACQPCHCHPAGVPLRPQCDSSGTCTCKANVTGWKCERCKDGY
HSLSEGGCRPCTCDPAGSVGTCDPNTGHCTCKERVEGHLCNRCQPGWFNLQPYNPIGCTS
CFCYGHSAVCMAADGYEVTHIRSDFREGLEGWAAAAGDVEVPLHWADGEIGTEWDKEEPL
DLRAPEKFLQNQRLSYGQPLSLLLGAEGNGTRAESGVFLLGVQLVLEGEGLQVTMSSSES
QAQDGKQAVTFRLHEAEEGTEPLLSAFSFQRLLSNLTALRLRVSRGPGPAGRLWLSRVQL
TSARRGAGMRAGWVEECTCPPSYTGSFCESCAPGFKRDIPFGGPFVTCVPCTCNQHGDCE
PLSGHCRCLHNTEGPSCERCSPGFYGNPFTGHPDDCKPCPCPGRSPCTQLPSSGEVVCTH
CPPGQRGKRCELCDDGFFGDPLGQRGPVRPCVPCQCHGNVDLNAVGNCDSVSGRCLRCLH
NTTGEQCQQCRPGFYGDALAPSPAGKCASCNCNPDGSALGLEGCDPGTGQCLCLPHVLGR
TCGLCQHGYYGLQAAVGCKSCECHPVGSQDSGCHAVTGQCSCQPGVTGLRCDRCEHGFFG
FSARGCRACNCSPLGSASAQCHENSTCLCRPGFVGYKCDRCQANFFPDPPSSSCQPCPTC
YGLVKDGVERLRVKLQEVEEWLQAPGCELRLGQPPVMGDESRGDGLSTQHLLQGAHAVLS
TQVGRLSGMLSTARGHLSNAIGASGCSSRGPPKTCTLLSKIRAVLHSAQQEILHAADTLA
ATCKEIPQEIPLLPTNWSRWATEARVLAERHGDTAAQVEAAVRRALGASNTSHELLRTLL
EGRVAQEAQRQLELSLLLHPTQGTGLVLQQLFALSPASLLLSHPQLQDRAGSAHDLSTSA
VSQGKSVLSGAESLLGSLEAWVTALGAQRLGVPTGMRKVLGHRKGRTALRRRMAQVRDRA
MVEAQKKIKQAEKMLGNSLSVSSAARRKAGEAVHVAGESSKRAQAVLQGSKQARKHTRTL
ATRVSETQQELYRQQRVAEELRGSLEEAEQVGTEVSEMAKSLREARGSLMADIETLNDLL
HSLG
Download sequence
Identical sequences ENSGALP00000006113 9031.ENSGALP00000006113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]