SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000007301 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000007301
Domain Number 1 Region: 456-700
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.19e-62
Family Nuclear receptor ligand-binding domain 0.000000000471
Further Details:      
 
Domain Number 2 Region: 339-415
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.96e-25
Family Nuclear receptor 0.0000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000007301   Gene: ENSGALG00000004596   Transcript: ENSGALT00000007313
Sequence length 702
Comment pep:known chromosome:WASHUC2:4:416134:460777:1 gene:ENSGALG00000004596 transcript:ENSGALT00000007313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVQLGIGRVYPRPPGRTFRGVFQTFFQSVCEAFQAPRDEPGPGLPAPGAPCPQSPRPPP
VASPAFLPLPEPRAAARPAMGSPFPCAGDLKELLGEPGVLPLLPPEAEPGAGRAEPALKE
DFLGDSAKELCKAVSASMGLAVETLEAPREPPPREDCMFALPGGPPRAPRPDAAEPPEPP
APAAFKGSGAEAALAVEVPAGLPLYRVSPPPEEPPGRDCFVLPPPARIKLESPPEPAAVG
AWGSPVPAPPWPFFADEGQLYGPCAEPPPGAFGCGRPENADFAADAWHPMARAPYAAPGS
CIKSELGPWAEGYAGAYGDVRLEAGREHILPIDYYFPPQKTCLICGDEASGCHYGALTCG
SCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGSL
KTQDEAEAASSSSPTEEQAPKMVMTHVNGFECQPIFLNVLEAIEPAVVCAGHDNSQPDSF
SNLLSSLNELGERQLVYVVKWAKALPGFRNLHVDDQMSIIQYSWMGLMIFAMGWRSFTNV
NSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRQLSQEFGWLQITPQEFLCMKALLFFSIIP
VDGLKNQKLFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKVLDSVHPIAKDLHQFT
FDLLIKAHMVSVDYPEMMAEIISVQVPKILSGKVKPIYFHAE
Download sequence
Identical sequences 9031.ENSGALP00000007301 ENSGALP00000007301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]