SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000007360 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000007360
Domain Number 1 Region: 510-564
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000781
Family Laminin-type module 0.0001
Further Details:      
 
Domain Number 2 Region: 26-84
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000698
Family Laminin-type module 0.0083
Further Details:      
 
Domain Number 3 Region: 459-512
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.00078
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000007360
Domain Number - Region: 378-416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000103
Family EGF-type module 0.053
Further Details:      
 
Domain Number - Region: 138-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000201
Family Laminin-type module 0.014
Further Details:      
 
Domain Number - Region: 82-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000502
Family Laminin-type module 0.0086
Further Details:      
 
Domain Number - Region: 637-715
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00262
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000007360   Gene: ENSGALG00000004627   Transcript: ENSGALT00000007372
Sequence length 1175
Comment pep:known chromosome:WASHUC2:8:7843214:7856655:1 gene:ENSGALG00000004627 transcript:ENSGALT00000007372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATCWLLALAASLLPAALSTSGGEACDCNGMSRQCVFDWQLLMETGNGYRCLGCLGNTAG
AHCERCKEGYYRQQDGDCCLPCRCHPQGSLSTQCDSNGRCSCRPGVMGEKCDRCQPGFHS
LSEAGCCPHCPRCRSQLCACDPAGTGDCVSGRCICKVGVTGERCDRCKQNFYNLDARNPA
GCSPCFCYGHSSSCVSAENYSIHKITSSFQQGPEGWTGVHEDRSPTELQWSPRHQDVFIA
ARRWEALYFVAPAKFLGNQQLSYGQTLSFDYRLDRGGRLPSPHDVILEGGGLRVTAPFLP
SGKVLPCGVSQTYTFRLDEHPSSKWSPRLNYFEYRRLLGNLTALWIRATFGEYSTGYIDN
ITLVSAQPAAGVLAPWVERCQCPDGYQGQFCERCAAGYRRDAPHMGPFSICVPCNCHGGG
ICDPDTGECYSGDENVGNSISCPFGSYRDPRPPHSCRACPCGHGQSCSVLPGQEEVVCDH
CPPGAAGPRCEFCADGYFGDPAASQPCRPCQCNSNVEPNAVGNCDRRTGECLKCIYNTAG
FHCERCKDGFFGNPLAPNPADKCRACNCNSVGAEPLMCRNDGSCICKPGFGGPNCEQSEC
PACYSQVKAQVDLYLQQLQELELLSSEVQAGGGAVGQELEGKMQLAEETLQAILREALSL
QASDRSLESRVTRLKGQGSTCQSRLDDAKAAVERLMSLGRQYERQAQDARRLLETARLDL
SNSGASLSRAAIPVSHFPGGSNKILLLAQEALSLANSHMQAANIIEQAAKAAQGIPPQAL
ELLQAAVSGGAEVPGSLQGLLRKYEELKLLAGGLEADANRIATEADKAYQSSLMLLSSLS
RLTKTSFGSFEGEAAQLKQDAAALLSTVDTYMAQYRQLQSRIGLWEEEIKKLLQRGEGER
AMLTQLLSRANLARSTALQAVSAGNATFYEVEQILKSLRGFNLQADDKRREAEDAMRRLS
VISSMVASAKEKTDRAEAILGNAAAESKAASSTAGEAKEITFGIQKEIMRLRLEANKTAD
GVLALEKAVAALQHEAKEVDGEFQSKVSEAEADAAMIQETTKEAQDVHTKAVQAGVVVQE
TLGVLEELLRLMNQPGAVDEEGLKQLELNFSKAKTKTNQLKEQMSELEQRATLQKVRVQK
LDSSIDEILADIRNLEDIQRSLPPGCYNTKAIELP
Download sequence
Identical sequences 9031.ENSGALP00000007360 ENSGALP00000007360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]