SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000007365 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000007365
Domain Number 1 Region: 1281-1415
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-32
Family Cadherin 0.00078
Further Details:      
 
Domain Number 2 Region: 1781-2009
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.18e-31
Family Laminin G-like module 0.0069
Further Details:      
 
Domain Number 3 Region: 2035-2234
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-30
Family Laminin G-like module 0.0056
Further Details:      
 
Domain Number 4 Region: 206-315
Classification Level Classification E-value
Superfamily Cadherin-like 1.01e-26
Family Cadherin 0.0016
Further Details:      
 
Domain Number 5 Region: 741-856
Classification Level Classification E-value
Superfamily Cadherin-like 1.7e-26
Family Cadherin 0.001
Further Details:      
 
Domain Number 6 Region: 420-528
Classification Level Classification E-value
Superfamily Cadherin-like 9.82e-25
Family Cadherin 0.00086
Further Details:      
 
Domain Number 7 Region: 953-1075
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-24
Family Cadherin 0.0013
Further Details:      
 
Domain Number 8 Region: 856-956
Classification Level Classification E-value
Superfamily Cadherin-like 1.14e-23
Family Cadherin 0.0014
Further Details:      
 
Domain Number 9 Region: 1065-1177
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-22
Family Cadherin 0.00045
Further Details:      
 
Domain Number 10 Region: 1173-1298
Classification Level Classification E-value
Superfamily Cadherin-like 4.45e-22
Family Cadherin 0.0012
Further Details:      
 
Domain Number 11 Region: 524-643
Classification Level Classification E-value
Superfamily Cadherin-like 2.22e-21
Family Cadherin 0.0047
Further Details:      
 
Domain Number 12 Region: 308-434
Classification Level Classification E-value
Superfamily Cadherin-like 3e-21
Family Cadherin 0.0011
Further Details:      
 
Domain Number 13 Region: 115-224
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-19
Family Cadherin 0.0014
Further Details:      
 
Domain Number 14 Region: 1393-1514
Classification Level Classification E-value
Superfamily Cadherin-like 8.11e-17
Family Cadherin 0.012
Further Details:      
 
Domain Number 15 Region: 4-101
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000757
Family Cadherin 0.0015
Further Details:      
 
Domain Number 16 Region: 632-748
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000357
Family Cadherin 0.003
Further Details:      
 
Domain Number 17 Region: 1502-1602
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000275
Family Cadherin 0.027
Further Details:      
 
Domain Number 18 Region: 2278-2316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000364
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000007365
Domain Number - Region: 2237-2265
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00968
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000007365   Gene: ENSGALG00000004630   Transcript: ENSGALT00000007377
Sequence length 2537
Comment pep:known chromosome:WASHUC2:11:10485844:10522303:-1 gene:ENSGALG00000004630 transcript:ENSGALT00000007377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTLTVMDVNDNIPEWAMEPFPFLAVVSPQATEGTEVYKLLAVDADEGINGTVEYFLLEGK
CGEGRFEVERDTGWIKTTGLPLVRNKEYLLTVLAADKLGSKGSPASVSVIAGFRPPQFTN
TSYLVYVPENIAEGKSFLRVTAVSYQNKSLSYALLANPSGLFSIDQATGDISLTRSVDYE
SDQHQYLLLVRAEENEQFSSATEVLVVITDVNDCAPEFHQSIYSKVSVPETVTMTTALLQ
VTATDCDSKENAEILYYTLSPDFSITSHGTIFPAKELDYERPNHLYEFIIMAVDKGEDPK
TGTATVRIHISNVNDEAPEFSQAIYRSFVSEDAGPNTLVATVSALDPDGDGVTYDIPSGN
QKGNFVVDPKKGLIRLRSSPFPKLQGTEYVLNVTATDDNASGGPHSLTSTAQVIVKIDDV
NNNKPVFQKCHYYREHASVLENQPSGTVVLQVEATDADEGANGIVKYGLMHRDGVLPAFS
IHPDTGVLTTVQVFDREKQREYPVTVTATDQAAEPLIGICQINVVILDQNDNDPRFENTH
YEYFLREDTRVGTSFLRVTAHDDDYSSNAVITYSIANEETDYLQINPTSGWIFVNQPISQ
RSSIIGDIIATDGGNRSSKVELVVTVTSAKNQPPQWERDSYEVVIPENTTRDASVLRIKA
TSPLGDPRVTYSLEEGLVPETNMPVRFYLTPNRYDGSASILVAELLDYETTKNFLLRVRA
QNVAAVPLAAFTTIYINITDVNDNVPFFTSSIYEASVTEGAGIGTFVIQVSATDLDLGQN
GEITYSLLHDHGGDYTCFRLDSQTGSIYTTSVFDREKKGSYLLEVESVDGSESARPGKHG
RPNSDTAYVRVFITDVNDNKPVFTQSVYEVNVVEDQDVGSTIITVSANDEDEGTNAKLRY
QITAGNTGGVLGVQPETGAIFIAQPLDYEETKMYEIHLLASDGKWEDYAVTIINVMNKND
ESPVFSINEYYGSIIEELDGLPVFVLQVMANDPDNNVEEGDLSYSLHGHGAADIFTIDEN
TGSIYAHKMLDREERALWRFVVLATDEGGEGLTGFADVIINVWDINDNAPVFTCMPDDCN
GSVFENSPADTLVMEMSAVDRDDPNVGLNAVLTYRITENVKNEFGSDMFNINPNTGTIHV
AGGVIDRERTAILFLTVEARDGGGLTGTGTATIWIADVNDHVPNFTKEMWQAAIPENSAI
NSEILRVSATDADGGENAHLTFSIIRGDPDQKFYIENDKEWQCATIRLKKQLDFEKAHER
QFNLTIKVEDLDFSSTAVCLIEVEDSNDHSPVFHSQLIQTSPIFENMPVGTTVTTVRATD
KDSGLNGNIIYSIKSDSDPMRQFVIDQHGHVIVANKLDREVIQKYSLIVQASDQGTPAET
GSATVLINLLDVNDNGPRFEAPYLPVVWENMLSPEIVHMNHSSKLLHAYDPDSEENGPPF
TFSLPPDYQNSLDFSLTDNRDDTATITALRSFDREKQKVFHLPIVITDSGIPVMSSTNTL
TITVGDENDNCHEFGHKDIYVYSNKGKWSTTVLGEVFAPDQDEWDNKTFLSEGKLFKFFR
LNQRTGSLMMVDNAPQGIYNLKVRVSDGLCPDVISTVQIHVKELENEAIQNSATVRLSDI
TAEEFLQSGERGKSRYNVFKELLAKMLSVKFSDIIVFGLMNADGKQADVRFAVHDGSAYY
RPEKLHAEMAAFKNEIQSALQVSISQIDVDECRSANCSEGSGCMNHLVVSNIPTVVDAGS
VSLVSVTTTISAVCTCAARNRVHQPCSSYARSPCLNGGMCIDTLNGYRCLCPASFHGPDC
QQTKHSFHGNGYAWFRPIRPCFESSLSLEFITAVPDGLLLYSGPLSNPEPGNTENFIAIE
ELSGGIPVLKMSHGLGSVMLQFPSHLNVTDKKWHQLEVRTNGQDVRFTLDHCSTAVVSEI
EGVGKWLSTDDRTNCEVFGSVPRRARYLNGNHVLQLGGVKESLPYSYPQLLHKHFSGCLR
NFILDSQKVYDLQSPAESLNSFPGCMLTDGSCEAMGSSSCGIHGRCLGDWGSFGCHCLPG
YYGYRCDKVAREYTFGPGSHIRYQLPISVPARRTLFEAMIRTRQPDSVITSMLSRNKDEH
ITLQVVRGFLAVSYNLGDGDYSVSLPSYNIDNGEWHHITLDRNENEFTLRLHEGGGKREI
LKAAGIYKEIVIDPSSLVLGNTYPFDLNKSFQVSLCLASGCMKDVRFNNYRIPLDTHTKE
LVSVLSARGVTEGCSSEACRNNPCNQEFICIDLWMMHECSCPPGHVIVENATGRQCVLTA
CAKRPCNYGTCISQSPTKFQCHCPDGYTGRNCEITLAIFHKDTGLTFSSMFAICICFLAL
LVCAVFLWARWKRHKGLEGGVHRAAADHDDLEDIRENILNYNEEGGGEQDQDAYNMAELQ
VSIQTSPAYSLYKKKVKTTKLNSFFSAASPSMQEQSRTRAFGHYLSDVVRDADHSPQAVP
HDLLQVFHTEGEGSVASGLSTLSSPEPDEAIVYDDIKDWGPKFEKLSELYSHTDAEDRTL
FLHTFVTQFQLMVTHFR
Download sequence
Identical sequences 9031.ENSGALP00000007365 ENSGALP00000007365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]