SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000007941 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000007941
Domain Number 1 Region: 907-974
Classification Level Classification E-value
Superfamily TB module/8-cys domain 9.03e-19
Family TB module/8-cys domain 0.00076
Further Details:      
 
Domain Number 2 Region: 2292-2364
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.4e-18
Family TB module/8-cys domain 0.00048
Further Details:      
 
Domain Number 3 Region: 669-811
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.51e-17
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 4 Region: 1070-1197
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.67e-17
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 5 Region: 2012-2081
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.14e-17
Family TB module/8-cys domain 0.0000189
Further Details:      
 
Domain Number 6 Region: 406-531
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.45e-17
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 7 Region: 2091-2219
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.24e-17
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 8 Region: 1807-1933
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.55e-17
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 9 Region: 500-612
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.44e-16
Family Growth factor receptor domain 0.0083
Further Details:      
 
Domain Number 10 Region: 610-683
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.83e-16
Family TB module/8-cys domain 0.00066
Further Details:      
 
Domain Number 11 Region: 1485-1558
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.09e-16
Family TB module/8-cys domain 0.0000181
Further Details:      
 
Domain Number 12 Region: 124-209
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.75e-16
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 13 Region: 2351-2485
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.43e-16
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 14 Region: 1644-1710
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000115
Family TB module/8-cys domain 0.00092
Further Details:      
 
Domain Number 15 Region: 272-337
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000942
Family TB module/8-cys domain 0.0016
Further Details:      
 
Domain Number 16 Region: 1196-1333
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000282
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 17 Region: 1323-1451
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000369
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 18 Region: 2449-2567
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000942
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 19 Region: 802-888
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000000000183
Family TB module/8-cys domain 0.0022
Further Details:      
 
Domain Number 20 Region: 984-1113
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000235
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 21 Region: 1966-2015
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000455
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 22 Region: 1564-1613
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000543
Family EGF-type module 0.00051
Further Details:      
 
Domain Number 23 Region: 2245-2294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000107
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 24 Region: 1726-1779
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000318
Family EGF-type module 0.0028
Further Details:      
 
Domain Number 25 Region: 159-282
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000392
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 26 Region: 1446-1494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000061
Family EGF-type module 0.00031
Further Details:      
 
Domain Number 27 Region: 1926-1969
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000914
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 28 Region: 1768-1805
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000028
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 29 Region: 1608-1650
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000595
Family EGF-type module 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000007941
Domain Number - Region: 2208-2250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000354
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 95-128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00369
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 61-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0778
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000007941   Gene: ENSGALG00000004960   Transcript: ENSGALT00000007955
Sequence length 2838
Comment pep:known chromosome:WASHUC2:10:11673560:11824138:-1 gene:ENSGALG00000004960 transcript:ENSGALT00000007955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PNVCGSRYNAYCCPGWKTLPGGNQCIVPICRHSCGDGFCSRPNMCTCPNGQIAPSCGSKS
IQHCNIRCMNGGSCSDDHCLCQKGYTGTHCGQPVCENGCLNGGRCVAPNRCACTYGFTGP
QCERDYRTGPCFTLVTNQMCQGQLSGIVCTKTLCCATVGRAWGHPCEMCPAQPHPCRRGF
IPNIRTGACQDVDECQAIPGICQGGNCINTVGSFECKCPAGHKFNEVTQKCDEDIDECST
IPGICDGGECSNTVSSYFCKCPPGFYTAPDGLKCIDVRPGYCFSTLTNGRCGNQLPQPLS
KMQCCCDSGRCWSSTAASAPEMCPIRSTDEYRKLCSVAALLPARPDLPPGRPEVIPPPLL
PGPYPPLVPLIPPPLLPGPYPPLVPQQPEIVYPSRAPPPHVILPVNFTDYCQLFRHLCLN
GHCIPTPGSYRCKCNKGFQLDVRGECIDVDECEKNPCISGDCVNTQGSYMCQCRIGYQST
PTRTECRDIDECLQNGRICNNGRCINTDGSFHCVCNAGFQVAADGKNCEDMDECNIRNMC
LNGMCINEDGSFKCICKPGFQLASDGRYCRDIDECETAGICMNGRCVNTDGSFRCECFPG
LAVGLDGRVCVDTHMRSTCYGGYKRGQCVRPLTGAVTKSECCCASTDYAFGEPCQPCPAQ
NSAEYQALCSSGSGMTAGGNDINECLLDPDLCPNGRCENLHGTYKCICNPGYEVDSTGKN
CIDIDECVLNTLLCDNGQCRNTPGSFTCTCPKGFVYTPDLKTCEDIDECESNPCVNGVCK
NTPGSFACECSPESTLDTTRTVCIETVKGTCWQNMVDGRCEININGATLKSECCSTLGAA
WGSPCTQCERDRICQKGFSRVRGTVCEEIDVNECEVFPGVCTNGQCVNTLGSFVCQCPSG
MTLDASGRTCLDIRLESCYLQHEDEQCTAQIPGRHRMDACCCSVGAAWGFECEECPLKGS
PEFEALCPRGAGFSTKIEITGKPFSKDINECKMVPSLCTHGKCRNTIGSFKCRCDSGFAL
DSEERNCTDIDECRISPDLCGQGICVNTPGDFECECFEGYESGFMMMKNCMDIDECQRNP
LLCRGGTCINTEGSFRCDCPPGHHISPNISACIDINECDLSTNLCRNGHCVNLIGKYQCA
CNPGYQSTADKLHCIDIDECSIMNGGCENFCTNSEGSYECSCKQGFALMPDHRTCTDIDE
CEDNPNICDGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNECDLHPNICLSGTCENTKG
SFICHCDMGYSGKKGTTGCTDINECEIGAHNCDRHAVCTNIPGSFKCSCSSGWIGNGIKC
TDLDECSNGTHKCSPHADCKNTMGSYRCLCKEGYTGDGFTCTDLDECSENLNLCENGQCL
NAPGGYRCECDMGFLPSLDGKACEDIDECSLPNICVYGTCHNLPGLFRCECEVGYELDRS
GGNCTADVNECADPTTCISGTCVNTAGSYTCECPPDFELNPTRVGCVDTRSGNCYLDIKT
RGDNGGTFCSNEIGVGVSKASCCCSLGRAWGVPCEQCPSVNTTEYKILCPGGEGFRPNPI
TVILEDIDECQELPGLCQGGKCINTFGSFQCQCPSGYYLNEETRVCDDVNECDTPGICGP
GTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCC
CSYNIGRAWNKPCEQCPIPSTDEFSTLCGSQRPGFFIDIYTGLPVDIDECREIPGVCENG
ICINMVGSFRCECPVGFFYNDKLLICEDIDECQNGPVCQQNAECVNTAGSYRCDCKPGYR
FTSTGRCTDRNECQEIPNICSHGQCIDTVGSFYCICHNGFKTNDDRTMCIDINECERDAC
ANGTCRNTIGSFNCRCNLGFILSHNNDCIDVDYCASGNGMLCRNGQCVNTIGSFQCLCND
GYEVSLDGRTCADVNECAREPGKCAPGTCQNLDGSFRCICPPGYVLQNEKCEDIDECVEQ
PEICALGTCSNTPGSFKCLCPEGFVLSSTGRRCQDLRVSYCFTKFEDGKCSVPKSRNHSK
QECCCALKGQGWGDPCELCPEEADVEAFRQICPFGIGILVGPGDARLDVDECLDPDNCKF
GQCINTDGSFRCECPYGYILQETQCVDTDECAVGNPCGNGTCRNVVGGFECTCVDGFEPG
PMMTCEDVNECIQNPLLCAFRCVNTFGSYECKCPAGYVLREDRRMCRDQNECEEGIHDCD
SKQMECKNLIGTYMCICGPGYQRRPDGEGCIDENECQTKPGLCENGRCVNTVGSYRCECN
EGFTVSDTQNECLDNREGYCFTEVLQSMCQIGSSNRNSVTKSECCCDGGRGWGPNCEVCP
FPGTVAFKKLCPHGRGYMSNGADIDECKVIHDVCRNGECINERGSYRCHCNLGYTTDITG
TLCIDLNECNESPKPCNFICKNTEGSFQCSCPKGYILQEDGRSCKDLDECATKQHNCQFL
CVNTIGGFTCKCPPGFTQHHTACIDNNECATEINLCGAKGICQNTPGSFVCECQRGFSLD
QTGLSCEDVDECDGNHRCQHGCQNIIGGYRCSCPQGYLQHYQWNQCVGKSLFIVYVWKCM
QLQVKGNGSLFTTFSGVTFQVSCPVKFQNYERFRQDCQFLNSQAPLKYSGSRTRMEKLCA
SHYHAGEVSKTHCVSGVGLGKGQGQELSLSGEMDDNSLSPEACYECKINGYPKRGRKRRS
TNETANEAEDEQELEPPVSLASWDIEKAAVFSINISDLSNKFRILKLLPALTTLTNHNRY
LIDSGNEDGFFRINKKDGISYLHFTKKKPVPGNYSLQISSIPLYKKKELNQLEEKHDKDY
LSGELGDNLKMKIQILLH
Download sequence
Identical sequences ENSGALP00000007941 9031.ENSGALP00000038092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]