SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000007962 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000007962
Domain Number 1 Region: 210-473
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.2e-83
Family Nuclear receptor ligand-binding domain 0.000000000297
Further Details:      
 
Domain Number 2 Region: 106-191
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.79e-28
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000007962   Gene: ENSGALG00000004974   Transcript: ENSGALT00000007976
Sequence length 475
Comment pep:known chromosome:WASHUC2:12:5069040:5089703:1 gene:ENSGALG00000004974 transcript:ENSGALT00000007976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDTEMPFWPVNFGISPVDLSAMDDHMHSFDIKPFTTVDFSSISSPHYEDIPLGRADQTS
IDYKYDIKLQDCQSAIKMEPPSPPYFSEKVQLYNKPHEESSNSLMAIECRVCGDKASGFH
YGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRF
GRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTT
DKSPFVIYDMNSLRMGEDQIKCKHASPLQEQNKEVAIRIFQRCQFRSVEAVQEITEFAKN
IPGFVNLDLNDQVTLLKYGVHEIIYTLLASLMNKDGVLISDGQGFMTREFLKSLRKPFCD
FMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLK
LNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQIIKKTETDMSLHPLLQEIYKDLY
Download sequence
Identical sequences G1N0E3 Q9I878
ENSGALP00000007962 ENSGALP00000007962 NP_001001460.1.86415 XP_015148417.1.86415 XP_015148419.1.86415 ENSMGAP00000004873 9031.ENSGALP00000007962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]