SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000008111 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000008111
Domain Number 1 Region: 59-568
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 4.24e-197
Family Myeloperoxidase-like 0.0000000000000332
Further Details:      
 
Domain Number 2 Region: 19-56
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000164
Family EGF-type module 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000008111   Gene: ENSGALG00000005069   Transcript: ENSGALT00000008125
Sequence length 603
Comment pep:known chromosome:WASHUC2:8:10059640:10067539:1 gene:ENSGALG00000005069 transcript:ENSGALT00000008125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPCALLAALLAAGHAANPCCSLPCQNRGVCMTTGFDRYECDCTRTGYYGENCTTPEFF
TWLKLILKPTPNTVHYILTHFKGVWNIINNISFLRDTIMRYVLTSRSHLIDSPPTYNSDY
SYKSWEAYSNLSYYTRSLPPVGHDCPTPMGVKGKKELPDSKLIVEKFLLRRKFIPDPQGT
NVMFTFFAQHFTHQFFKTDHKKGPGFTKAYGHGVDLNHIYGETLERQLKLRLRKDGKLKY
QMIDGEMYPPTVKDTQAEMIYPPHVPEHLQFSVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDEQLFQTTRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQRFQYQ
NRIAAEFNTLYHWHPLLPDTFQIHNQEYTFQQFLYNNSIMLEHGLSHMVKSFSKQSAGRV
AGGKNVPAAVQKVAKASIDQSRQMRYQSLNEYRKRFMLKPFKSFEELTGEKEMAAELEEL
YGDIDAMELYPGLLVEKPRPGAIFGETMVEIGAPFSLKGLMGNTICSPEYWKPSTFGGKV
GFEIINTASLQKLICNNVKGCPFTAFHVLNPEPTEATINVSTSNTAMEDINPTLLLKEQS
AEL
Download sequence
Identical sequences P27607
ENSGALP00000008111 NP_001161191.1.86415 9031.ENSGALP00000008111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]