SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000008549 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000008549
Domain Number 1 Region: 1910-2065
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.51e-55
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000181
Further Details:      
 
Domain Number 2 Region: 1758-1910
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.78e-51
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000186
Further Details:      
 
Domain Number 3 Region: 21-211
Classification Level Classification E-value
Superfamily Cupredoxins 5.21e-46
Family Multidomain cupredoxins 0.0000287
Further Details:      
 
Domain Number 4 Region: 386-572
Classification Level Classification E-value
Superfamily Cupredoxins 7.72e-44
Family Multidomain cupredoxins 0.0000451
Further Details:      
 
Domain Number 5 Region: 1612-1756
Classification Level Classification E-value
Superfamily Cupredoxins 2.86e-42
Family Multidomain cupredoxins 0.0000883
Further Details:      
 
Domain Number 6 Region: 1432-1602
Classification Level Classification E-value
Superfamily Cupredoxins 9.21e-37
Family Multidomain cupredoxins 0.0000537
Further Details:      
 
Domain Number 7 Region: 580-718
Classification Level Classification E-value
Superfamily Cupredoxins 1.01e-36
Family Multidomain cupredoxins 0.00013
Further Details:      
 
Domain Number 8 Region: 217-344
Classification Level Classification E-value
Superfamily Cupredoxins 8.68e-32
Family Multidomain cupredoxins 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000008549   Gene: ENSGALG00000005077   Transcript: ENSGALT00000008563
Sequence length 2070
Comment pep:known chromosome:WASHUC2:4:2126164:2145986:-1 gene:ENSGALG00000005077 transcript:ENSGALT00000008563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLGALRCLLLLSLLGEGSGEVRRYYIGAVETAWDYVHSELLSTLQAPVGQKPLPGMSLS
PPMRDGDGHSKAVFVEYLDASFTQPKPKPAWMGLLGPTIRAEVYDTVVITFKNLASRPYN
LHAVGVSYWKASEGAGYEDETSQPEQEGDRVDPGETHTYIWEIQQDQGPTDGDSQCLTHS
YSSNVNSVKDTNSGLIGALLVCRPGTLVRDGAQNMQQDLVMLFAVFDEGKSWYSEPNSPA
HSRTELHTINGYINSSLPGLTLCHRKQVHWHVIASGTGPEVHSIFFEGHTFLVRGHRLSS
LEISPATYLTAQTMPGTAGSFRVFCQMPSHQQAGMEAVVKVEECPDEIQQKMGQPSDEPE
YTDEAEEEDEEGYHVIQVRSFAKKDPVMWTHYIAAEEMDWDYAPVKPPSLDRNTSRLFLE
AGPQRIGSKYKKVMFVEYEDATFKKRKVSSQPGQGILGPVLKGEVGDQFKIVFRNLASRP
YNIYPHGLTSVNPYHAMKPSQEKDVKDIPIAPGQSFTYRWSITTEDGPTQADPRCLTRFY
YSSINPVQDTASGLIGPLLICFKKSMDQRGNQIMSDDMRLVLFSVFDENRSWYLEENIRR
FCTDAAHVDKQDPEFYASNVMHTINGFVFDNLQLQLCLHEVVYWYVLSVGAQSDFLSVFF
SGNTFKRNMVSEDVLTLFPFSGETVFMSVEKTGVWTLGCRNPDFRDRGMHAKFTVTQCQL
EGSLDEEEYEDYEEEDFELQPRGFSKRKNKRRPCVSEQPNNVTSPKNGTRKPALCLTESS
HRALPHNGTNPGPSSNGTSAFPGSPHPDDVSTSSLPETYYDPVSYESFLADEEELSKTIS
QDQGAGALPSGKHISGEVRGTVTSREGLYQSKPAPEDAMVERKVTNVLEVQEPAKAAVVQ
AGGTLQMLETETQKPTAHTYDLWNSTVFAAGKGPLQGTRSSFQQDGPEHSLGLQVTSSEG
ADVTPLNLHESREPSNTGPTLGSNHNSSFTPASPLGPSARTEDIGTSQSHSVESNRSSSE
LDAKLNKRPHKVVSQGFNESLGGENISFSDLQRVQEQILTDMRNSLPANSSMEEAKGTFA
HSNDLEPSRYLPTEERDELILEAVFQDATATKDLPETDSLVLPQSNLVANDTRQFPNALS
MGVPGSRPRQARSLQSRGLEHGLGLPSPTSGSRESLTVGSGAGQDRRSSSLLTQAAPQSQ
AVMAASSSALQDGNNGTDVASNWDPVSPGEAGRAVGLQSPALAAMQPGGGAAWGALWSRQ
AQGRSQLEEETNAVEQPDRERTWFSPQHLEANATENSVSESTSGQKPDEIPTKVAPKENT
SLPLSSPAFNHSTVEKPDKHVQASSDGQQVVLGRKDVPAETGKVEEPEEDGESGSTVGKR
SHAAEHGDNLNNETLSGLSMSESNITDYDDYSDTEQDFDIYGENEHDPRSFQGQIRQYFI
AAMEVIWEYGNQRPQHFLKATDPTSGRRKPFRQYRKVIFREYLDGSFTQPAMRGELDEHL
GILGPYIRAEIEDTIMVKFKNLASRPFSFHSSLQGYEELHGGEAVQPGEVREYSWKVLSQ
MAPTMQEFDCKAWAYLSNVDLEKDLHSGLIGPLIICRRGVLNSAFKRQLAVQEFSLLFTI
FDETKRWYFPENMRRNCRPPCRIQLDNPDFRRNHSFHAINGYVGDTLPGLVMAQQQRIRW
HLLNMGSTEDIHSVHFHGQMFSIRTSQEYRMGVYNLYPGVFGTVEMQPSHAGIWRVECKV
GEHLQAGMSALFLVYNQDCQNALGMASGYIADSQITASGQEGPWAPKLARLHNSGSINAW
STGEGNPWIQVDLLHLKIIHGIKTQGARQRLSSLYVSQFIVFYSLDGQRWKKYKGNTTST
QMMFFANVDATTVKENRFNPPIIARYIRINPTHYSIRTTLRMELIGCDLNSCSMPLGMES
KGIPDQRISASSYSSNIFSSWSPSQARLNLQGRTNAWRPETNSPSEWLQVDFEATKKVTA
IITQGAKAVFTHMFVKEFAVSSSQDGVHWSRVLHNGKEKIFRANRDYTSTVLNSLEPPLF
ARYVRIHPRHWHNHIALRIEFLGCDTQQEY
Download sequence
Identical sequences ENSGALP00000008549 9031.ENSGALP00000008549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]