SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000009054 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000009054
Domain Number 1 Region: 1-178
Classification Level Classification E-value
Superfamily p53-like transcription factors 7.15e-52
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000029
Further Details:      
 
Domain Number 2 Region: 174-305
Classification Level Classification E-value
Superfamily E set domains 3.03e-45
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000213
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000009054   Gene: ENSGALG00000005653   Transcript: ENSGALT00000009068
Sequence length 379
Comment pep:known chromosome:WASHUC2:6:18022985:18025183:1 gene:ENSGALG00000005653 transcript:ENSGALT00000009068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FRYGCGGPSLQGGRPGDSEREGRPYPTVKICNYEGMARIEVDLVTHSDPPRVHAHSLVGK
QCNEAGNCVAIVGPKDMTAQFSNLGVLHVTKKNMMEIMKEKLKKQKTRNTNGLLTEAELR
EIELEAKELKKVMDLSIVRLRFTAYLRDSSGNFTLALQPVISDPIHDSKSPGASNLKISR
MDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTP
PYHKPKIDRPVTVFLQLKRKRGGDVSDSKQFTYYPVVEDKEEVERKRKKVLPQFPQHFGG
GSHMGGAGGAGGFGAGGGGNLSFPYSSGLGYNNLYSSSPHPVGGGYQGGVQMKAASESGD
GDDRQAPTESTYCRELQRH
Download sequence
Identical sequences 9031.ENSGALP00000009054 ENSGALP00000009054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]