SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000009255 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000009255
Domain Number 1 Region: 94-212
Classification Level Classification E-value
Superfamily PX domain 7.85e-16
Family PX domain 0.0024
Further Details:      
 
Domain Number 2 Region: 291-346
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000137
Family SAM (sterile alpha motif) domain 0.0064
Further Details:      
 
Domain Number 3 Region: 892-923
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000907
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000009255   Gene: ENSGALG00000005771   Transcript: ENSGALT00000009269
Sequence length 947
Comment pep:known chromosome:WASHUC2:11:19767501:19813382:-1 gene:ENSGALG00000005771 transcript:ENSGALT00000009269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNHPAFSFHQKQVLRQELTQIQNIMASTSKNPSTSTLNSMATYPGCHKVTARSETPIN
SVSNSLENVLHTSTHSIEESLPKRPSGKHSKVSVEKVELKGLAHKKNERNVEYSFEVLWS
DSSVTLVTKSSVEVTEFISKLSQLYPEENLEKFIPCLAGPDSFYLERNHMDLESDLRYLA
PLPSHVVKNDHVRKFFSTSSPSQQLQSSNPGNPSLYKVGTTLGTSGRPICGVAGIQSSQN
HVQHSAAAPVALPHCSHSGGTGSSLAYRNQMDAASPMLMSSSPQTPQTQEQNGILDWLRK
LRLHKYYPVFKQLTMEKKFLSLTEEDLNKFESLTMGAKKKLKTQLELEKEKSEKRCLNPT
TPSSVTSSGVARVPPTTHVGPLQSIRGNHAAELRVDVDQPAHPLPREGSSSEYSSSSSSP
MGIQTREESSDSAEENERRLEIHLDGSEKEKPVMLLNHFTSSSARPTAQVLPVQNDAGSN
PSGHHTLPMQMMSAASTHITPIRMLNSVHKSERGNADMKLLSSSMHSLLSLEERNKVSPG
PRGSIKMEKSFGNTVVDVMTAPSPHQPLQVLSGAAENSSPTSTINFGPRTKVVHASTLDR
VMKTAQQPGLIVETSTAATVTSSTVFHVARPPIKLLVSSSVPTDPAIAGQTSCSSNMQIT
VSPAIINPRTALYTANTKVAFSAMSSVPVAPMQGSFCANSNAASSSSHPSTSFATMANLP
SCPAPSSSPTLSSVAENNFYSNSSSSSSSSSSSSSGSAGSIPVPNQNHHHHHHQQQQPQP
PGCMVCSSCGCSGNCGSSGMTVSYANYFQHPFSGPSMFTFPFLPFNPLCSNGYINTQQYN
SSTTFPVVHTAYNSGIAPDSVMTGQSTFAVPPMQNFMAGTAGVYQAQGMMGNTNGSSHKK
NGNLSCYNCGASGHRAQDCKQPPMDFNRQGTFRLKYAPPSESLDSTD
Download sequence
Identical sequences ENSGALP00000009255 9031.ENSGALP00000009255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]