SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000009466 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000009466
Domain Number 1 Region: 784-892
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-24
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 2 Region: 323-443
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.42e-18
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 3 Region: 46-175
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000188
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 285-329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000628
Family EGF-type module 0.021
Further Details:      
 
Domain Number 5 Region: 176-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000186
Family EGF-type module 0.02
Further Details:      
 
Domain Number 6 Region: 216-257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000484
Family EGF-type module 0.025
Further Details:      
 
Domain Number 7 Region: 654-780
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000162
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000009466   Gene: ENSGALG00000005892   Transcript: ENSGALT00000009480
Sequence length 970
Comment pep:known chromosome:WASHUC2:5:10452786:10487041:1 gene:ENSGALG00000005892 transcript:ENSGALT00000009480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGGRPSAAGARALPLLLLLLPAPGPAAPPPPGECRALTPRSHVDECALGLDDCHPDAI
CQNTPKLYKCMCKVGFTGEGKKCEDIDECDNDFNGGCVHECFNIPGNYRCTCYDGFMLAH
DGHNCLDTDECMFNNGGCQHVCVNTVGSYECRCKEGFFLSDNQHTCIHRSEEGMSCMNKD
HGCAHICRETPKGGVACECRPGFELSKNQRSCILTCNHGNGGCQHTCDDADNGPICGCHP
KYIMHTDGKTCLEREEAAVEIPEGNTTAGADVDKRVKRRLLMETCAVNNGGCDRTCKDTS
TGVHCSCPVGFTLQFDGKTCKDIDECQSNNGGCDHFCKNTVGSFDCSCRKGFKLLTDEKS
CQDIDECSFERTCDHTCINHPGTFECTCNKGYALYGFTHCGDINECSINNGGCQQLCVNT
PGDYECLCHSNYKLHWNKKDCVEIKESFPDNMSPKVLLHCMKSGRSDRCFLSCSSDVRVV
SGTQDAYTLACGSSSQLKKKQQNTNASTWLEDISTIKISVTFKLNEGKCSLKKTEMFQEG
LEQTIPERHNSVMESFHYVNLTCSSGKKVHGALSRLPATREIFITADFELETNQKEVTDT
CDVRCARKKTEKRFRKTIRTLRKTVSRDQFRVRVSGMDHEVARKSLKLSEPQQSCGVGQM
HVGSRCDQCSPGEYSSDGFKPCLPCPIGTYQPEAGRVSCFPCGGGLTTRHSSTSLFQDCE
TKVQCSPGHFYNTTTHRCIRCMVGTYQPEFGQNYCISCPGNTTTDYDGSTNITQCKNRQC
GGELGDYTGYIESPNYPGDYPANTECTWNINPPPKRRILIVVPEIFLPIEDECGDYLVMR
KSSSSNSVTTYETCQTYERPIAFTSRSKKLWIQFKSNEGNSAKGFQVPYVTYDEDYQELI
EDIVRDGRLYASENHQEILKDKKLIKALFDVLAHPQNYFKYTAQESREMFPRSFIRLLRS
KVSRFLRPYK
Download sequence
Identical sequences 9031.ENSGALP00000009466 ENSGALP00000009466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]