SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000009711 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000009711
Domain Number 1 Region: 975-1155
Classification Level Classification E-value
Superfamily Fibronectin type III 2.42e-17
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 2 Region: 724-766
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000073
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 3 Region: 762-801
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000137
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 4 Region: 385-423
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000185
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 5 Region: 878-958
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000206
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 6 Region: 309-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000274
Family EGF-type module 0.0037
Further Details:      
 
Domain Number 7 Region: 765-875
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000173
Family Growth factor receptor domain 0.0069
Further Details:      
 
Domain Number 8 Region: 618-655
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000204
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 9 Region: 541-577
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000252
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 10 Region: 429-467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000589
Family EGF-type module 0.013
Further Details:      
 
Domain Number 11 Region: 581-617
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000755
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 12 Region: 668-723
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000181
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 13 Region: 349-389
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000322
Family EGF-type module 0.018
Further Details:      
 
Domain Number 14 Region: 269-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000323
Family EGF-type module 0.0085
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000009711
Domain Number - Region: 471-501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000115
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 505-536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00683
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000009711   Gene: ENSGALG00000006039   Transcript: ENSGALT00000009725
Sequence length 1182
Comment pep:known chromosome:WASHUC2:9:5931551:5954058:1 gene:ENSGALG00000006039 transcript:ENSGALT00000009725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGPAGWVALAALLGEWLRAGGVVPLADFYPFGPAQGDAATLKQDDGGSELRPLSVRFPF
FGAGHTGLYVNNNGIISFLKEVSQFTPVAFPISKDRRVVAAFWADVDNRRAGDVYYRESQ
DRAILERATRDIARYFPEFPDFSAQWVFIATWYRVTFFGGSSFSPVNTFQIVLITDGKLS
FTIFNYESITWTTGMHASSGGDFAGLGGIAAQAGFNAGDGKRYFNIPGSRTDDIADVEMT
TNVGIPGRWVFRIDDAQVQVGGCSNTTSVCLTLRPCLNGGKCIEDCITGNPSYTCSCLAG
FTGKRCHVDVDECLSHPCQNGATCINSVNSFSCQCLPGFRGASCEIEESPCETKVCQNGG
TCQVANGTAVCTCQPGYAGGDCETEVNECESSPCLNGGHCVDLVDNYTCVCLEPFVGQRC
ETGGPRVPSACLSNPCQNGGSCLELEQGYACDCPEGYAGQDCRDKLTEGCECRNGGSCLE
GNVTICQCLPGYFGLLCEFEVTTTPCNVNTQCPDGGYCMEYGGSYLCVCHTDYGTNHTVP
SPCDSEPCLNGGSCETQDDSYTCECPSGFLGKHCERARPRLCSTAPCRNGGTCKEADGEY
HCACPYRFTGRHCEIGKPDPCASGPCQNGGTCFHYIGKYKCDCAPGYAGRHCEIGTCGSL
TPHLSAEIDCGIPSAVKHAQASFNSLVGSLAKYHCELGYVLSQHNSPRVCRSQGVWSDPP
ECDEIDECRSQPCLNGGQCKDRIAEFLCVCEPGYTGLHCELEVDECQSEPCKNGGTCRDL
LGSFACSCPAGFMGTQCEEEVDACESDPCQNGGECEGDGGSYLCVCPEGFFGYHCETASD
PCFSSPCGSRGYCLPSNGTHSCTCKVSYTGKSCEKELLPPTSLKVERVEDTGVLISWHPP
EDAAARQLIDGYAVTYVSFDGSYRRTDFVDRSRSAHQLRALASGRAYNISVFSVKRNVNN
KNDISRPVMLTTRTRPRPVEGFEITNVTASTITVQWALHRLKHSTVSRVRVSIRQPGDLE
DRTVELNSSVAKYTFLQSLQLQRYIVHVTTLSGMGTEDHPSESLATAPFHVWTRPLPPRN
LTASRVTPTSVSVTWEQPPTGAVEGYIINVTTAQSVKSRYVPNGKLASYTVRDLLPAQRY
RLSVTAVQNTEQGQVHSEPIHLYVTTLQKDGAPERRWSQAGH
Download sequence
Identical sequences ENSGALP00000009711 9031.ENSGALP00000009711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]